TOP
UniProt ID:
P01034
Entry Name:
CYTC_HUMAN
Sequence:
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Molecular Function
Biological Process
Cellular Component
Score (%) 34.36~83.12
GO Terms Score Description
GO:0008150 83.12% biological_process
GO:0050896 65.63% response to stimulus
GO:0065007 58.53% biological regulation
GO:0050789 57.57% regulation of biological process
GO:0050794 56.91% regulation of cellular process
GO:0031323 56.27% regulation of cellular metabolic process
GO:0019222 55.72% regulation of metabolic process
GO:0060255 53.12% regulation of macromolecule metabolic process
GO:0080090 47.70% regulation of primary metabolic process
GO:0051171 46.25% regulation of nitrogen compound metabolic process
GO:0048519 45.80% negative regulation of biological process
GO:0048523 45.17% negative regulation of cellular process
GO:0006950 42.58% response to stress
GO:0032268 42.27% regulation of cellular protein metabolic process
GO:0051246 42.15% regulation of protein metabolic process
GO:0009987 39.13% cellular process
GO:0048518 37.49% positive regulation of biological process
GO:0048522 37.48% positive regulation of cellular process
GO:0030162 37.32% regulation of proteolysis
GO:0009892 37.13% negative regulation of metabolic process
GO:0031324 36.41% negative regulation of cellular metabolic process
GO:0045861 35.87% negative regulation of proteolysis
GO:0051172 35.39% negative regulation of nitrogen compound metabolic process
GO:0010605 34.81% negative regulation of macromolecule metabolic process
GO:0051239 34.36% regulation of multicellular organismal process
GO:0031325 34.18% positive regulation of cellular metabolic process
GO:0009893 34.07% positive regulation of metabolic process
GO:0032269 33.88% negative regulation of cellular protein metabolic process
GO:0010604 33.87% positive regulation of macromolecule metabolic process
GO:0051248 33.39% negative regulation of protein metabolic process
GO:0065009 31.58% regulation of molecular function
GO:0050793 31.11% regulation of developmental process
GO:0006952 30.90% defense response
GO:0031329 30.44% regulation of cellular catabolic process
GO:0032502 30.16% developmental process
GO:0050790 30.01% regulation of catalytic activity
GO:0052547 29.77% regulation of peptidase activity
GO:0051346 29.75% negative regulation of hydrolase activity
GO:0009894 29.05% regulation of catabolic process
GO:0048856 28.60% anatomical structure development
GO:0008284 28.58% positive regulation of cell population proliferation
GO:0051336 28.49% regulation of hydrolase activity
GO:0010466 28.29% negative regulation of peptidase activity
GO:0043086 28.09% negative regulation of catalytic activity
GO:0051128 27.96% regulation of cellular component organization
GO:0044092 27.44% negative regulation of molecular function
GO:0042127 27.03% regulation of cell population proliferation
GO:0031330 26.94% negative regulation of cellular catabolic process
GO:0009895 26.12% negative regulation of catabolic process
GO:0009889 26.11% regulation of biosynthetic process
GO:0045740 25.75% positive regulation of DNA replication
GO:0010712 25.62% regulation of collagen metabolic process
GO:0022603 25.54% regulation of anatomical structure morphogenesis
GO:0006275 25.42% regulation of DNA replication
GO:0071840 25.39% cellular component organization or biogenesis
GO:0016043 25.29% cellular component organization
GO:0010941 25.27% regulation of cell death
GO:0031326 24.88% regulation of cellular biosynthetic process
GO:0043067 24.87% regulation of programmed cell death
GO:0048869 24.81% cellular developmental process
GO:0051241 24.70% negative regulation of multicellular organismal process
GO:0051093 24.69% negative regulation of developmental process
GO:0042176 23.95% regulation of protein catabolic process
GO:0009891 23.85% positive regulation of biosynthetic process
GO:0009605 23.73% response to external stimulus
GO:0010556 23.30% regulation of macromolecule biosynthetic process
GO:2000112 23.22% regulation of cellular macromolecule biosynthetic process
GO:0051129 23.00% negative regulation of cellular component organization
GO:0042221 22.85% response to chemical
GO:0060548 22.78% negative regulation of cell death
GO:0042177 22.70% negative regulation of protein catabolic process
GO:0010033 22.40% response to organic substance
GO:0031328 22.37% positive regulation of cellular biosynthetic process
GO:0010557 21.99% positive regulation of macromolecule biosynthetic process
GO:0097435 21.59% supramolecular fiber organization
GO:0006979 21.53% response to oxidative stress
GO:1903053 21.37% regulation of extracellular matrix organization
GO:0034104 20.92% negative regulation of tissue remodeling
GO:0034103 20.77% regulation of tissue remodeling
GO:0051716 20.67% cellular response to stimulus
GO:1903018 19.66% regulation of glycoprotein metabolic process
GO:0009628 18.83% response to abiotic stimulus
GO:1901700 18.77% response to oxygen-containing compound
GO:0009725 18.52% response to hormone
GO:0009719 18.44% response to endogenous stimulus
GO:0048513 18.43% animal organ development
GO:0022414 18.25% reproductive process
GO:0009991 18.09% response to extracellular stimulus
GO:0051173 18.08% positive regulation of nitrogen compound metabolic process
GO:0009593 17.87% detection of chemical stimulus
GO:0033993 17.78% response to lipid
GO:0051606 17.76% detection of stimulus
GO:0031667 17.60% response to nutrient levels
GO:0014070 17.59% response to organic cyclic compound
GO:0070887 17.58% cellular response to chemical stimulus
GO:0050906 17.36% detection of stimulus involved in sensory perception
GO:0001580 17.31% detection of chemical stimulus involved in sensory perception of bitter taste
GO:0070482 17.28% response to oxygen levels
GO:0050912 17.26% detection of chemical stimulus involved in sensory perception of taste
GO:0050907 17.17% detection of chemical stimulus involved in sensory perception
GO:0006955 17.10% immune response
GO:0033554 17.09% cellular response to stress
GO:0003006 17.08% developmental process involved in reproduction
GO:0008219 16.66% cell death
GO:0002376 16.25% immune system process
GO:0065008 16.18% regulation of biological quality
GO:0006915 16.02% apoptotic process
GO:0012501 15.80% programmed cell death
GO:0036293 15.68% response to decreased oxygen levels
GO:0008406 15.57% gonad development
GO:0048468 15.56% cell development
GO:0001666 15.50% response to hypoxia
GO:0032355 15.48% response to estradiol
GO:0009636 15.44% response to toxic substance
GO:0009611 15.36% response to wounding
GO:0007610 15.30% behavior
GO:0051240 15.28% positive regulation of multicellular organismal process
GO:0042493 15.21% response to drug
GO:0010035 15.13% response to inorganic substance
GO:0046677 14.88% response to antibiotic
GO:0009607 14.84% response to biotic stimulus
GO:1901701 14.74% cellular response to oxygen-containing compound
GO:0043207 14.74% response to external biotic stimulus
GO:0030154 14.74% cell differentiation
GO:0008584 14.60% male gonad development
GO:0048511 14.24% rhythmic process
GO:0009410 14.22% response to xenobiotic stimulus
GO:0048732 14.15% gland development
GO:0051704 14.13% multi-organism process
GO:0001775 14.02% cell activation
GO:0000302 13.67% response to reactive oxygen species
GO:0048608 13.60% reproductive structure development
GO:0007623 13.52% circadian rhythm
GO:0042542 13.43% response to hydrogen peroxide
GO:0042592 13.40% homeostatic process
GO:0034614 13.25% cellular response to reactive oxygen species
GO:0051707 13.19% response to other organism
GO:0097237 12.92% cellular response to toxic substance
GO:0048583 12.89% regulation of response to stimulus
GO:0051094 12.70% positive regulation of developmental process
GO:0071236 12.59% cellular response to antibiotic
GO:0032501 12.49% multicellular organismal process
GO:0009743 12.46% response to carbohydrate
GO:0035690 12.37% cellular response to drug
GO:2000026 12.31% regulation of multicellular organismal development
GO:0010468 12.19% regulation of gene expression
GO:0070301 12.05% cellular response to hydrogen peroxide
GO:0001934 12.05% positive regulation of protein phosphorylation
GO:0042325 11.98% regulation of phosphorylation
GO:0098542 11.96% defense response to other organism
GO:0034599 11.92% cellular response to oxidative stress
GO:0007622 11.79% rhythmic behavior
GO:0051247 11.76% positive regulation of protein metabolic process
GO:0032270 11.73% positive regulation of cellular protein metabolic process
GO:0042327 11.73% positive regulation of phosphorylation
GO:0009653 11.64% anatomical structure morphogenesis
GO:0048512 11.62% circadian behavior
GO:0048678 11.56% response to axon injury
GO:0001932 11.48% regulation of protein phosphorylation
GO:0019220 11.40% regulation of phosphate metabolic process
GO:0051174 11.40% regulation of phosphorus metabolic process
GO:0009617 11.23% response to bacterium
GO:0009888 11.17% tissue development
GO:0001894 11.11% tissue homeostasis
GO:0007566 10.95% embryo implantation
GO:0007423 10.82% sensory organ development
GO:0060249 10.74% anatomical structure homeostasis
GO:0007165 10.64% signal transduction
GO:0045937 10.60% positive regulation of phosphate metabolic process
GO:0006959 10.59% humoral immune response
GO:0080134 10.46% regulation of response to stress
GO:0042742 10.40% defense response to bacterium
GO:0010562 10.30% positive regulation of phosphorus metabolic process
GO:0048584 10.16% positive regulation of response to stimulus
GO:0051962 10.15% positive regulation of nervous system development
GO:0002064 10.13% epithelial cell development
GO:0050679 9.89% positive regulation of epithelial cell proliferation
GO:0019730 9.85% antimicrobial humoral response
GO:0001654 9.83% eye development
GO:0031401 9.83% positive regulation of protein modification process
GO:0007420 9.82% brain development
GO:0007154 9.80% cell communication
GO:0010628 9.53% positive regulation of gene expression
GO:0052548 9.49% regulation of endopeptidase activity
GO:0050678 9.49% regulation of epithelial cell proliferation
GO:0003008 9.44% system process
GO:0050727 9.25% regulation of inflammatory response
GO:0061844 9.23% antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0006954 9.18% inflammatory response
GO:0042981 9.13% regulation of apoptotic process
GO:0048585 9.09% negative regulation of response to stimulus
GO:0031644 9.03% regulation of nervous system process
GO:0007281 8.99% germ cell development
GO:0007166 8.99% cell surface receptor signaling pathway
GO:0031347 8.95% regulation of defense response
GO:0032101 8.92% regulation of response to external stimulus
GO:0021700 8.88% developmental maturation
GO:1902531 8.85% regulation of intracellular signal transduction
GO:0051960 8.82% regulation of nervous system development
GO:1901698 8.61% response to nitrogen compound
GO:0019219 8.60% regulation of nucleobase-containing compound metabolic process
GO:0045595 8.57% regulation of cell differentiation
GO:0007286 8.56% spermatid development
GO:0050829 8.56% defense response to Gram-negative bacterium
GO:0040008 8.55% regulation of growth
GO:0045597 8.54% positive regulation of cell differentiation
GO:0044057 8.53% regulation of system process
GO:0009967 8.43% positive regulation of signal transduction
GO:0031399 8.39% regulation of protein modification process
GO:0045087 8.33% innate immune response
GO:0010243 8.30% response to organonitrogen compound
GO:1902533 8.27% positive regulation of intracellular signal transduction
GO:0002237 8.26% response to molecule of bacterial origin
GO:0008152 8.25% metabolic process
GO:0009966 8.22% regulation of signal transduction
GO:0051130 8.19% positive regulation of cellular component organization
GO:0032102 8.09% negative regulation of response to external stimulus
GO:0008283 8.07% cell population proliferation
GO:0023056 8.01% positive regulation of signaling
GO:0001895 7.98% retina homeostasis
GO:0007267 7.97% cell-cell signaling
GO:0023052 7.97% signaling
GO:0010951 7.95% negative regulation of endopeptidase activity
GO:0048469 7.92% cell maturation
GO:2000116 7.88% regulation of cysteine-type endopeptidase activity
GO:0010647 7.87% positive regulation of cell communication
GO:0045935 7.80% positive regulation of nucleobase-containing compound metabolic process
GO:0022412 7.79% cellular process involved in reproduction in multicellular organism
GO:0034097 7.78% response to cytokine
GO:0010720 7.76% positive regulation of cell development
GO:0031960 7.75% response to corticosteroid
GO:0010629 7.71% negative regulation of gene expression
GO:0071310 7.66% cellular response to organic substance
GO:0043069 7.65% negative regulation of programmed cell death
GO:0048638 7.65% regulation of developmental growth
GO:0060284 7.58% regulation of cell development
GO:0044093 7.55% positive regulation of molecular function
GO:0043066 7.48% negative regulation of apoptotic process
GO:0023051 7.43% regulation of signaling
GO:0071496 7.42% cellular response to external stimulus
GO:0009314 7.36% response to radiation
GO:0010646 7.36% regulation of cell communication
GO:0010976 7.34% positive regulation of neuron projection development
GO:0007218 7.33% neuropeptide signaling pathway
GO:0043408 7.32% regulation of MAPK cascade
GO:0048232 7.32% male gamete generation
GO:0031346 7.30% positive regulation of cell projection organization
GO:0070613 7.29% regulation of protein processing
GO:0031348 7.28% negative regulation of defense response
GO:0007568 7.28% aging
GO:0051384 7.28% response to glucocorticoid
GO:0002682 7.23% regulation of immune system process
GO:0080135 7.23% regulation of cellular response to stress
GO:0007283 7.13% spermatogenesis
GO:0032496 7.11% response to lipopolysaccharide
GO:0050769 7.05% positive regulation of neurogenesis
GO:0035821 7.04% modification of morphology or physiology of other organism
GO:0022607 7.00% cellular component assembly
GO:0001817 7.00% regulation of cytokine production
GO:1901360 6.96% organic cyclic compound metabolic process
GO:0048609 6.96% multicellular organismal reproductive process
GO:0050728 6.95% negative regulation of inflammatory response
GO:0044419 6.92% interspecies interaction between organisms
GO:0007167 6.90% enzyme linked receptor protein signaling pathway
GO:0007276 6.88% gamete generation
GO:0044237 6.85% cellular metabolic process
GO:0001819 6.84% positive regulation of cytokine production
GO:0006928 6.76% movement of cell or subcellular component
GO:0002062 6.76% chondrocyte differentiation
GO:0009887 6.75% animal organ morphogenesis
GO:0043410 6.69% positive regulation of MAPK cascade
GO:0043434 6.68% response to peptide hormone
GO:1903317 6.67% regulation of protein maturation
GO:0002526 6.64% acute inflammatory response
GO:1901215 6.63% negative regulation of neuron death
GO:0008285 6.62% negative regulation of cell population proliferation
GO:0001101 6.60% response to acid chemical
GO:1901652 6.59% response to peptide
GO:0045786 6.58% negative regulation of cell cycle
GO:0048646 6.58% anatomical structure formation involved in morphogenesis
GO:0051252 6.56% regulation of RNA metabolic process
GO:0009890 6.54% negative regulation of biosynthetic process
GO:0006725 6.54% cellular aromatic compound metabolic process
GO:0010942 6.51% positive regulation of cell death
GO:0062012 6.47% regulation of small molecule metabolic process
GO:0050830 6.46% defense response to Gram-positive bacterium
GO:0032677 6.44% regulation of interleukin-8 production
GO:0007569 6.41% cell aging
GO:0043170 6.40% macromolecule metabolic process
GO:0045666 6.39% positive regulation of neuron differentiation
GO:0048545 6.36% response to steroid hormone
GO:0050795 6.36% regulation of behavior
GO:0043068 6.33% positive regulation of programmed cell death
GO:0031668 6.32% cellular response to extracellular stimulus
GO:0002443 6.29% leukocyte mediated immunity
GO:0006953 6.28% acute-phase response
GO:0051052 6.28% regulation of DNA metabolic process
GO:0045930 6.25% negative regulation of mitotic cell cycle
GO:0002683 6.22% negative regulation of immune system process
GO:0043065 6.22% positive regulation of apoptotic process
GO:0009416 6.21% response to light stimulus
GO:0006355 6.20% regulation of transcription, DNA-templated
GO:0097305 6.20% response to alcohol
GO:0002252 6.19% immune effector process
GO:2001141 6.19% regulation of RNA biosynthetic process
GO:0071704 6.19% organic substance metabolic process
GO:0040011 6.18% locomotion
GO:0031646 6.17% positive regulation of nervous system process
GO:0001906 6.16% cell killing
GO:0048146 6.16% positive regulation of fibroblast proliferation
GO:0031214 6.15% biomineral tissue development
GO:0110148 6.11% biomineralization
GO:1903506 6.08% regulation of nucleic acid-templated transcription
GO:0010467 6.07% gene expression
GO:0045862 6.05% positive regulation of proteolysis
GO:0070372 6.05% regulation of ERK1 and ERK2 cascade
GO:0070997 6.05% neuron death
GO:0050767 6.04% regulation of neurogenesis
GO:0070374 6.00% positive regulation of ERK1 and ERK2 cascade
GO:0010506 5.98% regulation of autophagy
GO:0009266 5.95% response to temperature stimulus
GO:0071495 5.94% cellular response to endogenous stimulus
GO:0050877 5.91% nervous system process
GO:0031327 5.90% negative regulation of cellular biosynthetic process
GO:0071453 5.87% cellular response to oxygen levels
GO:0006810 5.84% transport
GO:0051254 5.84% positive regulation of RNA metabolic process
GO:1901214 5.84% regulation of neuron death
GO:0019221 5.83% cytokine-mediated signaling pathway
GO:0031669 5.78% cellular response to nutrient levels
GO:0001909 5.78% leukocyte mediated cytotoxicity
GO:2000117 5.78% negative regulation of cysteine-type endopeptidase activity
GO:0043085 5.77% positive regulation of catalytic activity
GO:0071216 5.76% cellular response to biotic stimulus
GO:0104004 5.76% cellular response to environmental stimulus
GO:0051234 5.74% establishment of localization
GO:0071214 5.69% cellular response to abiotic stimulus
GO:0010608 5.68% posttranscriptional regulation of gene expression
GO:0042594 5.68% response to starvation
GO:0002694 5.67% regulation of leukocyte activation
GO:0150077 5.67% regulation of neuroinflammatory response
GO:0051179 5.60% localization
GO:0071345 5.59% cellular response to cytokine stimulus
GO:0031641 5.56% regulation of myelination
GO:0007169 5.55% transmembrane receptor protein tyrosine kinase signaling pathway
GO:0001558 5.54% regulation of cell growth
GO:2000241 5.52% regulation of reproductive process
GO:0046427 5.52% positive regulation of receptor signaling pathway via JAK-STAT
GO:0048870 5.50% cell motility
GO:0032757 5.49% positive regulation of interleukin-8 production
GO:0043030 5.49% regulation of macrophage activation
GO:0050673 5.45% epithelial cell proliferation
GO:0008544 5.44% epidermis development
GO:0006919 5.44% activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0046483 5.42% heterocycle metabolic process
GO:0006807 5.41% nitrogen compound metabolic process
GO:0048534 5.41% hematopoietic or lymphoid organ development
GO:0050865 5.40% regulation of cell activation
GO:0044238 5.40% primary metabolic process
GO:0051881 5.39% regulation of mitochondrial membrane potential
GO:0045927 5.39% positive regulation of growth
GO:2000242 5.39% negative regulation of reproductive process
GO:0048731 5.36% system development
GO:1903706 5.35% regulation of hemopoiesis
GO:0034644 5.35% cellular response to UV
GO:1903508 5.30% positive regulation of nucleic acid-templated transcription
GO:0031331 5.29% positive regulation of cellular catabolic process
GO:0010955 5.28% negative regulation of protein processing
GO:0034612 5.28% response to tumor necrosis factor
GO:1902680 5.27% positive regulation of RNA biosynthetic process
GO:0045321 5.26% leukocyte activation
GO:0071542 5.26% dopaminergic neuron differentiation
GO:0030099 5.25% myeloid cell differentiation
GO:0045893 5.24% positive regulation of transcription, DNA-templated
GO:0090304 5.23% nucleic acid metabolic process
GO:0010927 5.22% cellular component assembly involved in morphogenesis
GO:1904894 5.21% positive regulation of receptor signaling pathway via STAT
GO:1903318 5.21% negative regulation of protein maturation
GO:0010948 5.20% negative regulation of cell cycle process
GO:0043933 5.20% protein-containing complex subunit organization
GO:0019216 5.20% regulation of lipid metabolic process
GO:1901654 5.18% response to ketone
GO:0071396 5.17% cellular response to lipid
GO:0048145 5.17% regulation of fibroblast proliferation
GO:0043524 5.16% negative regulation of neuron apoptotic process
GO:0001938 5.14% positive regulation of endothelial cell proliferation
GO:0070555 5.12% response to interleukin-1
GO:2001233 5.12% regulation of apoptotic signaling pathway
GO:0072593 5.10% reactive oxygen species metabolic process
GO:0048565 5.10% digestive tract development
GO:0002702 5.07% positive regulation of production of molecular mediator of immune response
GO:0006986 5.04% response to unfolded protein
GO:0048872 5.03% homeostasis of number of cells
GO:0051726 5.03% regulation of cell cycle
GO:0007275 5.02% multicellular organism development
GO:0043523 5.02% regulation of neuron apoptotic process
GO:0009896 5.02% positive regulation of catabolic process
GO:0032098 5.01% regulation of appetite
GO:1903205 5.01% regulation of hydrogen peroxide-induced cell death
GO:0071456 4.98% cellular response to hypoxia
GO:0006629 4.97% lipid metabolic process
GO:0065003 4.97% protein-containing complex assembly
GO:0007600 4.95% sensory perception
GO:0051930 4.94% regulation of sensory perception of pain
GO:0071356 4.93% cellular response to tumor necrosis factor
GO:0051385 4.93% response to mineralocorticoid
GO:0018958 4.93% phenol-containing compound metabolic process
GO:0016070 4.93% RNA metabolic process
GO:0010975 4.92% regulation of neuron projection development
GO:0071478 4.90% cellular response to radiation
GO:0051302 4.90% regulation of cell division
GO:0044764 4.89% multi-organism cellular process
GO:0051338 4.89% regulation of transferase activity
GO:0019835 4.87% cytolysis
GO:0045637 4.85% regulation of myeloid cell differentiation
GO:0010038 4.85% response to metal ion
GO:0035556 4.85% intracellular signal transduction
GO:0032879 4.81% regulation of localization
GO:0045187 4.81% regulation of circadian sleep/wake cycle, sleep
GO:2000278 4.80% regulation of DNA biosynthetic process
GO:0007186 4.80% G protein-coupled receptor signaling pathway
GO:0045333 4.79% cellular respiration
GO:0002449 4.78% lymphocyte mediated immunity
GO:0090329 4.77% regulation of DNA-dependent DNA replication
GO:0022600 4.76% digestive system process
GO:0050890 4.76% cognition
GO:0050810 4.76% regulation of steroid biosynthetic process
GO:0051591 4.75% response to cAMP
GO:0030534 4.75% adult behavior
GO:0031344 4.75% regulation of cell projection organization
GO:0051347 4.74% positive regulation of transferase activity
GO:0016525 4.73% negative regulation of angiogenesis
GO:0002695 4.73% negative regulation of leukocyte activation
GO:0010558 4.73% negative regulation of macromolecule biosynthetic process
GO:0001889 4.72% liver development
GO:0071229 4.72% cellular response to acid chemical
GO:0120035 4.72% regulation of plasma membrane bounded cell projection organization
GO:0042698 4.72% ovulation cycle
GO:0031334 4.71% positive regulation of protein complex assembly
GO:0016477 4.70% cell migration
GO:0007631 4.70% feeding behavior
GO:0010165 4.69% response to X-ray
GO:0040014 4.69% regulation of multicellular organism growth
GO:0009612 4.68% response to mechanical stimulus
GO:1903555 4.68% regulation of tumor necrosis factor superfamily cytokine production
GO:0006139 4.68% nucleobase-containing compound metabolic process
GO:0045765 4.68% regulation of angiogenesis
GO:0071219 4.68% cellular response to molecule of bacterial origin
GO:2001235 4.66% positive regulation of apoptotic signaling pathway
GO:0032989 4.65% cellular component morphogenesis
GO:0036294 4.65% cellular response to decreased oxygen levels
GO:0007160 4.64% cell-matrix adhesion
GO:0051931 4.63% regulation of sensory perception
GO:0032870 4.63% cellular response to hormone stimulus
GO:0030182 4.62% neuron differentiation
GO:0034641 4.59% cellular nitrogen compound metabolic process
GO:0045664 4.59% regulation of neuron differentiation
GO:2001038 4.59% regulation of cellular response to drug
GO:0097190 4.58% apoptotic signaling pathway
GO:0042749 4.58% regulation of circadian sleep/wake cycle
GO:0009566 4.57% fertilization
GO:0001936 4.55% regulation of endothelial cell proliferation
GO:0009620 4.54% response to fungus
GO:0090305 4.53% nucleic acid phosphodiester bond hydrolysis
GO:0007605 4.52% sensory perception of sound
GO:0006508 4.52% proteolysis
GO:0006091 4.52% generation of precursor metabolites and energy
GO:1901342 4.52% regulation of vasculature development
GO:0072089 4.49% stem cell proliferation
GO:0019098 4.49% reproductive behavior
GO:1903859 4.47% regulation of dendrite extension
GO:0002521 4.47% leukocyte differentiation
GO:0007626 4.47% locomotory behavior
GO:0046425 4.47% regulation of receptor signaling pathway via JAK-STAT
GO:0051852 4.47% disruption by host of symbiont cells
GO:0008344 4.46% adult locomotory behavior
GO:0006996 4.46% organelle organization
GO:2000181 4.44% negative regulation of blood vessel morphogenesis
GO:0031640 4.44% killing of cells of other organism
GO:0042752 4.44% regulation of circadian rhythm
GO:1904892 4.43% regulation of receptor signaling pathway via STAT
GO:0032722 4.43% positive regulation of chemokine production
GO:0035295 4.42% tube development
GO:0046890 4.42% regulation of lipid biosynthetic process
GO:1901343 4.41% negative regulation of vasculature development
GO:0006457 4.39% protein folding
GO:0023057 4.39% negative regulation of signaling
GO:0010212 4.39% response to ionizing radiation
GO:0050866 4.39% negative regulation of cell activation
GO:0031099 4.39% regeneration
GO:0002274 4.38% myeloid leukocyte activation
GO:0032103 4.37% positive regulation of response to external stimulus
GO:0035966 4.36% response to topologically incorrect protein
GO:0030878 4.36% thyroid gland development
GO:0051784 4.35% negative regulation of nuclear division
GO:1901564 4.35% organonitrogen compound metabolic process
GO:0045944 4.35% positive regulation of transcription by RNA polymerase II
GO:0048589 4.35% developmental growth
GO:0045934 4.34% negative regulation of nucleobase-containing compound metabolic process
GO:0048878 4.33% chemical homeostasis
GO:2000377 4.33% regulation of reactive oxygen species metabolic process
GO:0033363 4.32% secretory granule organization
GO:0044706 4.32% multi-multicellular organism process
GO:0051873 4.32% killing by host of symbiont cells
GO:0010648 4.32% negative regulation of cell communication
GO:0043281 4.31% regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043254 4.30% regulation of protein complex assembly
GO:2000113 4.30% negative regulation of cellular macromolecule biosynthetic process
GO:0015980 4.30% energy derivation by oxidation of organic compounds
GO:1901031 4.30% regulation of response to reactive oxygen species
GO:0006974 4.29% cellular response to DNA damage stimulus
GO:1903201 4.28% regulation of oxidative stress-induced cell death
GO:0060259 4.28% regulation of feeding behavior
GO:0031349 4.27% positive regulation of defense response
GO:0071347 4.26% cellular response to interleukin-1
GO:0006357 4.26% regulation of transcription by RNA polymerase II
GO:0002067 4.26% glandular epithelial cell differentiation
GO:0009267 4.25% cellular response to starvation
GO:0043549 4.24% regulation of kinase activity
GO:1903861 4.24% positive regulation of dendrite extension
GO:0045926 4.22% negative regulation of growth
GO:0048863 4.22% stem cell differentiation
GO:0009056 4.21% catabolic process
GO:0044364 4.20% disruption of cells of other organism
GO:0051090 4.20% regulation of DNA-binding transcription factor activity
GO:0017148 4.19% negative regulation of translation
GO:0007584 4.19% response to nutrient
GO:0050832 4.19% defense response to fungus
GO:0019538 4.18% protein metabolic process
GO:0010817 4.17% regulation of hormone levels
GO:0002699 4.15% positive regulation of immune effector process
GO:0009755 4.15% hormone-mediated signaling pathway
GO:0040007 4.15% growth
GO:0044703 4.15% multi-organism reproductive process
GO:0050729 4.14% positive regulation of inflammatory response
GO:0050954 4.14% sensory perception of mechanical stimulus
GO:0055114 4.14% oxidation-reduction process
GO:1902105 4.13% regulation of leukocyte differentiation
GO:0009408 4.13% response to heat
GO:1901615 4.13% organic hydroxy compound metabolic process
GO:0051091 4.13% positive regulation of DNA-binding transcription factor activity
GO:0031100 4.11% animal organ regeneration
GO:0006109 4.10% regulation of carbohydrate metabolic process
GO:0007049 4.09% cell cycle
GO:0051193 4.09% regulation of cofactor metabolic process
GO:0030307 4.07% positive regulation of cell growth
GO:0007417 4.07% central nervous system development
GO:0009790 4.06% embryo development
GO:0051818 4.06% disruption of cells of other organism involved in symbiotic interaction
GO:0007005 4.06% mitochondrion organization
GO:0042391 4.05% regulation of membrane potential
GO:0010669 4.05% epithelial structure maintenance
GO:0061351 4.05% neural precursor cell proliferation
GO:0006417 4.04% regulation of translation
GO:0045859 4.03% regulation of protein kinase activity
GO:1903557 4.02% positive regulation of tumor necrosis factor superfamily cytokine production
GO:0010564 4.02% regulation of cell cycle process
GO:0045471 4.02% response to ethanol
GO:0046649 4.01% lymphocyte activation
GO:0097421 4.01% liver regeneration
GO:0071222 4.01% cellular response to lipopolysaccharide
GO:0032680 4.00% regulation of tumor necrosis factor production
GO:1903202 4.00% negative regulation of oxidative stress-induced cell death
GO:0019731 3.99% antibacterial humoral response
GO:0006468 3.98% protein phosphorylation
GO:0022904 3.98% respiratory electron transport chain
GO:2000177 3.98% regulation of neural precursor cell proliferation
GO:0048017 3.98% inositol lipid-mediated signaling
GO:0033574 3.97% response to testosterone
GO:0045639 3.96% positive regulation of myeloid cell differentiation
GO:0048639 3.96% positive regulation of developmental growth
GO:0009411 3.96% response to UV
GO:1900407 3.95% regulation of cellular response to oxidative stress
GO:0051883 3.94% killing of cells in other organism involved in symbiotic interaction
GO:0051054 3.94% positive regulation of DNA metabolic process
GO:0044248 3.93% cellular catabolic process
GO:0071900 3.92% regulation of protein serine/threonine kinase activity
GO:1903203 3.92% regulation of oxidative stress-induced neuron death
GO:0007611 3.91% learning or memory
GO:0002684 3.91% positive regulation of immune system process
GO:0071417 3.90% cellular response to organonitrogen compound
GO:0032094 3.90% response to food
GO:0007617 3.90% mating behavior
GO:0007219 3.90% Notch signaling pathway
GO:0010952 3.88% positive regulation of peptidase activity
GO:0045834 3.88% positive regulation of lipid metabolic process
GO:0014074 3.88% response to purine-containing compound
GO:0050730 3.87% regulation of peptidyl-tyrosine phosphorylation
GO:0043393 3.87% regulation of protein binding
GO:0042060 3.87% wound healing
GO:0008217 3.87% regulation of blood pressure
GO:0032981 3.87% mitochondrial respiratory chain complex I assembly
GO:1900408 3.86% negative regulation of cellular response to oxidative stress
GO:0044087 3.85% regulation of cellular component biogenesis
GO:1901099 3.85% negative regulation of signal transduction in absence of ligand
GO:0034284 3.84% response to monosaccharide
GO:0014065 3.84% phosphatidylinositol 3-kinase signaling
GO:0002460 3.84% adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0003013 3.84% circulatory system process
GO:0010906 3.84% regulation of glucose metabolic process
GO:0016310 3.83% phosphorylation
GO:0003012 3.83% muscle system process
GO:0010810 3.79% regulation of cell-substrate adhesion
GO:0009968 3.79% negative regulation of signal transduction
GO:1901987 3.78% regulation of cell cycle phase transition
GO:2001039 3.78% negative regulation of cellular response to drug
GO:0009792 3.78% embryo development ending in birth or egg hatching
GO:0019218 3.77% regulation of steroid metabolic process
GO:0030097 3.76% hemopoiesis
GO:0044089 3.76% positive regulation of cellular component biogenesis
GO:0050878 3.76% regulation of body fluid levels
GO:0048521 3.76% negative regulation of behavior
GO:0090066 3.75% regulation of anatomical structure size
GO:0034249 3.74% negative regulation of cellular amide metabolic process
GO:0033043 3.74% regulation of organelle organization
GO:0009746 3.73% response to hexose
GO:0022610 3.73% biological adhesion
GO:0043627 3.71% response to estrogen
GO:0034622 3.71% cellular protein-containing complex assembly
GO:0022900 3.70% electron transport chain
GO:0046620 3.70% regulation of organ growth
GO:0002784 3.70% regulation of antimicrobial peptide production
GO:0051896 3.69% regulation of protein kinase B signaling
GO:0061024 3.68% membrane organization
GO:0090659 3.68% walking behavior
GO:0051817 3.68% modification of morphology or physiology of other organism involved in symbiotic interaction
GO:0042445 3.67% hormone metabolic process
GO:0030278 3.67% regulation of ossification
GO:0010950 3.67% positive regulation of endopeptidase activity
GO:0043900 3.67% regulation of multi-organism process
GO:0006351 3.66% transcription, DNA-templated
GO:0033273 3.66% response to vitamin
GO:0040013 3.65% negative regulation of locomotion
GO:1901699 3.65% cellular response to nitrogen compound
GO:0051345 3.65% positive regulation of hydrolase activity
GO:0045596 3.64% negative regulation of cell differentiation
GO:0071482 3.64% cellular response to light stimulus
GO:0046903 3.63% secretion
GO:0002700 3.63% regulation of production of molecular mediator of immune response
GO:2001056 3.62% positive regulation of cysteine-type endopeptidase activity
GO:0061013 3.62% regulation of mRNA catabolic process
GO:0030098 3.62% lymphocyte differentiation
GO:2001240 3.62% negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
GO:0031670 3.62% cellular response to nutrient
GO:0051702 3.62% interaction with symbiont
GO:0043280 3.62% positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051607 3.60% defense response to virus
GO:0010821 3.59% regulation of mitochondrion organization
GO:0097659 3.59% nucleic acid-templated transcription
GO:0033138 3.59% positive regulation of peptidyl-serine phosphorylation
GO:0030334 3.59% regulation of cell migration
GO:0030856 3.59% regulation of epithelial cell differentiation
GO:0051098 3.59% regulation of binding
GO:1902882 3.59% regulation of response to oxidative stress
GO:0043487 3.58% regulation of RNA stability
GO:0009615 3.58% response to virus
GO:0051412 3.57% response to corticosterone
GO:0019725 3.57% cellular homeostasis
GO:0009058 3.57% biosynthetic process
GO:0032091 3.57% negative regulation of protein binding
GO:0040012 3.56% regulation of locomotion
GO:0097191 3.55% extrinsic apoptotic signaling pathway
GO:2001236 3.55% regulation of extrinsic apoptotic signaling pathway
GO:0050731 3.54% positive regulation of peptidyl-tyrosine phosphorylation
GO:2000145 3.54% regulation of cell motility
GO:1902532 3.54% negative regulation of intracellular signal transduction
GO:0001525 3.54% angiogenesis
GO:1900117 3.54% regulation of execution phase of apoptosis
GO:0021987 3.53% cerebral cortex development
GO:0001541 3.53% ovarian follicle development
GO:0071695 3.52% anatomical structure maturation
GO:0009749 3.52% response to glucose
GO:1903311 3.52% regulation of mRNA metabolic process
GO:2001239 3.51% regulation of extrinsic apoptotic signaling pathway in absence of ligand
GO:0007155 3.50% cell adhesion
GO:0022604 3.50% regulation of cell morphogenesis
GO:0010758 3.49% regulation of macrophage chemotaxis
GO:0033500 3.49% carbohydrate homeostasis
GO:1904018 3.49% positive regulation of vasculature development
GO:1902883 3.49% negative regulation of response to oxidative stress
GO:0055093 3.49% response to hyperoxia
GO:1903998 3.48% regulation of eating behavior
GO:0051781 3.48% positive regulation of cell division
GO:0007346 3.48% regulation of mitotic cell cycle
GO:0044260 3.48% cellular macromolecule metabolic process
GO:0071346 3.47% cellular response to interferon-gamma
GO:0010811 3.47% positive regulation of cell-substrate adhesion
GO:0001818 3.47% negative regulation of cytokine production
GO:0008637 3.47% apoptotic mitochondrial changes
GO:0030218 3.47% erythrocyte differentiation
GO:0048666 3.46% neuron development
GO:0046683 3.46% response to organophosphorus
GO:0033189 3.46% response to vitamin A
GO:0007628 3.45% adult walking behavior
GO:0007565 3.45% female pregnancy
GO:0048580 3.44% regulation of post-embryonic development
GO:0010565 3.44% regulation of cellular ketone metabolic process
GO:0050680 3.44% negative regulation of epithelial cell proliferation
GO:2000648 3.43% positive regulation of stem cell proliferation
GO:0042403 3.43% thyroid hormone metabolic process
GO:0035902 3.42% response to immobilization stress
GO:0034248 3.42% regulation of cellular amide metabolic process
GO:1903429 3.42% regulation of cell maturation
GO:0032755 3.42% positive regulation of interleukin-6 production
GO:2001023 3.42% regulation of response to drug
GO:1902806 3.40% regulation of cell cycle G1/S phase transition
GO:0044255 3.39% cellular lipid metabolic process
GO:0050953 3.39% sensory perception of light stimulus
GO:0031175 3.39% neuron projection development
GO:0010257 3.39% NADH dehydrogenase complex assembly
GO:0072091 3.38% regulation of stem cell proliferation
GO:0001822 3.38% kidney development
GO:0033674 3.38% positive regulation of kinase activity
GO:0007586 3.38% digestion
GO:0071827 3.38% plasma lipoprotein particle organization
GO:0002761 3.38% regulation of myeloid leukocyte differentiation
GO:0010639 3.37% negative regulation of organelle organization
GO:0032642 3.37% regulation of chemokine production
GO:0031589 3.37% cell-substrate adhesion
GO:0008610 3.37% lipid biosynthetic process
GO:0048520 3.36% positive regulation of behavior
GO:0062013 3.36% positive regulation of small molecule metabolic process
GO:0098781 3.36% ncRNA transcription
GO:0043488 3.36% regulation of mRNA stability
GO:0002251 3.36% organ or tissue specific immune response
GO:0051049 3.36% regulation of transport
GO:0045766 3.36% positive regulation of angiogenesis
GO:0070584 3.35% mitochondrion morphogenesis
GO:0051897 3.35% positive regulation of protein kinase B signaling
GO:0008625 3.35% extrinsic apoptotic signaling pathway via death domain receptors
GO:2000573 3.35% positive regulation of DNA biosynthetic process
GO:0051592 3.35% response to calcium ion
GO:0036296 3.35% response to increased oxygen levels
GO:0010634 3.35% positive regulation of epithelial cell migration
GO:0061458 3.34% reproductive system development
GO:0043902 3.34% positive regulation of multi-organism process
GO:0043009 3.34% chordate embryonic development
GO:0050994 3.34% regulation of lipid catabolic process
GO:0032675 3.34% regulation of interleukin-6 production
GO:0007589 3.34% body fluid secretion
GO:2000146 3.34% negative regulation of cell motility
GO:0045661 3.33% regulation of myoblast differentiation
GO:0061138 3.32% morphogenesis of a branching epithelium
GO:0007422 3.32% peripheral nervous system development
GO:0051270 3.32% regulation of cellular component movement
GO:0120161 3.32% regulation of cold-induced thermogenesis
GO:0043401 3.32% steroid hormone mediated signaling pathway
GO:0002920 3.32% regulation of humoral immune response
GO:0007601 3.30% visual perception
GO:1900076 3.30% regulation of cellular response to insulin stimulus
GO:1903034 3.30% regulation of response to wounding
GO:0034341 3.30% response to interferon-gamma
GO:0007338 3.30% single fertilization
GO:0070542 3.30% response to fatty acid
GO:0033135 3.29% regulation of peptidyl-serine phosphorylation
GO:0001763 3.29% morphogenesis of a branching structure
GO:0009914 3.29% hormone transport
GO:0046879 3.29% hormone secretion
GO:0010675 3.28% regulation of cellular carbohydrate metabolic process
GO:0051253 3.27% negative regulation of RNA metabolic process
GO:0048660 3.26% regulation of smooth muscle cell proliferation
GO:0010507 3.26% negative regulation of autophagy
GO:0045940 3.26% positive regulation of steroid metabolic process
GO:0048015 3.26% phosphatidylinositol-mediated signaling
GO:0006582 3.26% melanin metabolic process
GO:0002759 3.26% regulation of antimicrobial humoral response
GO:0033032 3.26% regulation of myeloid cell apoptotic process
GO:0042593 3.26% glucose homeostasis
GO:0009791 3.26% post-embryonic development
GO:0032940 3.26% secretion by cell
GO:0042531 3.25% positive regulation of tyrosine phosphorylation of STAT protein
GO:0044249 3.25% cellular biosynthetic process
GO:0001709 3.23% cell fate determination
GO:0051260 3.23% protein homooligomerization
GO:0032760 3.23% positive regulation of tumor necrosis factor production
GO:0007606 3.23% sensory perception of chemical stimulus
GO:0042509 3.23% regulation of tyrosine phosphorylation of STAT protein
GO:0030879 3.22% mammary gland development
GO:2000045 3.21% regulation of G1/S transition of mitotic cell cycle
GO:0010893 3.21% positive regulation of steroid biosynthetic process
GO:0017144 3.20% drug metabolic process
GO:0014823 3.20% response to activity
GO:0051271 3.20% negative regulation of cellular component movement
GO:0045860 3.20% positive regulation of protein kinase activity
GO:0030030 3.20% cell projection organization
GO:1901990 3.19% regulation of mitotic cell cycle phase transition
GO:0007612 3.19% learning
GO:2000379 3.19% positive regulation of reactive oxygen species metabolic process
GO:0098743 3.19% cell aggregation
GO:0045598 3.18% regulation of fat cell differentiation
GO:0030518 3.18% intracellular steroid hormone receptor signaling pathway
GO:0010632 3.18% regulation of epithelial cell migration
GO:0043200 3.18% response to amino acid
GO:0120162 3.17% positive regulation of cold-induced thermogenesis
GO:0042440 3.17% pigment metabolic process
GO:0002250 3.17% adaptive immune response
GO:2000243 3.16% positive regulation of reproductive process
GO:0055088 3.16% lipid homeostasis
GO:1903708 3.16% positive regulation of hemopoiesis
GO:0040018 3.16% positive regulation of multicellular organism growth
GO:0043405 3.16% regulation of MAP kinase activity
GO:0006970 3.15% response to osmotic stress
GO:0043467 3.14% regulation of generation of precursor metabolites and energy
GO:1901575 3.14% organic substance catabolic process
GO:0090501 3.13% RNA phosphodiester bond hydrolysis
GO:0070848 3.13% response to growth factor
GO:0002639 3.12% positive regulation of immunoglobulin production
GO:0001503 3.11% ossification
GO:0071407 3.11% cellular response to organic cyclic compound
GO:0032774 3.11% RNA biosynthetic process
GO:0034655 3.10% nucleobase-containing compound catabolic process
GO:0051051 3.10% negative regulation of transport
GO:0002697 3.10% regulation of immune effector process
GO:2001234 3.09% negative regulation of apoptotic signaling pathway
GO:0051851 3.09% modification by host of symbiont morphology or physiology
GO:2000105 3.09% positive regulation of DNA-dependent DNA replication
GO:0043901 3.08% negative regulation of multi-organism process
GO:0048640 3.08% negative regulation of developmental growth
GO:0090287 3.08% regulation of cellular response to growth factor stimulus
GO:0032104 3.08% regulation of response to extracellular stimulus
GO:0045777 3.08% positive regulation of blood pressure
GO:0032965 3.07% regulation of collagen biosynthetic process
GO:0006909 3.07% phagocytosis
GO:0018209 3.07% peptidyl-serine modification
GO:0045839 3.07% negative regulation of mitotic nuclear division
GO:0051092 3.06% positive regulation of NF-kappaB transcription factor activity
GO:0014068 3.06% positive regulation of phosphatidylinositol 3-kinase signaling
GO:0072331 3.06% signal transduction by p53 class mediator
GO:0071322 3.06% cellular response to carbohydrate stimulus
GO:0002922 3.05% positive regulation of humoral immune response
GO:0038034 3.05% signal transduction in absence of ligand
GO:0042119 3.05% neutrophil activation
GO:0001667 3.05% ameboidal-type cell migration
GO:1901532 3.05% regulation of hematopoietic progenitor cell differentiation
GO:0014066 3.04% regulation of phosphatidylinositol 3-kinase signaling
GO:2001024 3.04% negative regulation of response to drug
GO:0051186 3.04% cofactor metabolic process
GO:0043062 3.04% extracellular structure organization
GO:0097192 3.04% extrinsic apoptotic signaling pathway in absence of ligand
GO:0009409 3.03% response to cold
GO:0030336 3.03% negative regulation of cell migration
GO:0097193 3.03% intrinsic apoptotic signaling pathway
GO:0071260 3.02% cellular response to mechanical stimulus
GO:0010039 3.02% response to iron ion
GO:0032107 3.02% regulation of response to nutrient levels
GO:1904407 3.01% positive regulation of nitric oxide metabolic process
GO:0120036 3.01% plasma membrane bounded cell projection organization
GO:0046889 3.01% positive regulation of lipid biosynthetic process
GO:0006793 3.01% phosphorus metabolic process
GO:0030858 3.01% positive regulation of epithelial cell differentiation
GO:0034605 3.00% cellular response to heat
GO:0071702 3.00% organic substance transport
GO:0010638 3.00% positive regulation of organelle organization
GO:0051046 2.99% regulation of secretion
GO:0090559 2.99% regulation of membrane permeability
GO:0001678 2.98% cellular glucose homeostasis
GO:0010677 2.98% negative regulation of cellular carbohydrate metabolic process
GO:0045619 2.98% regulation of lymphocyte differentiation
GO:0098916 2.98% anterograde trans-synaptic signaling
GO:1905521 2.98% regulation of macrophage migration
GO:0034368 2.95% protein-lipid complex remodeling
GO:0042100 2.95% B cell proliferation
GO:0006721 2.94% terpenoid metabolic process
GO:0045833 2.94% negative regulation of lipid metabolic process
GO:0070098 2.94% chemokine-mediated signaling pathway
GO:0071333 2.94% cellular response to glucose stimulus
GO:0022612 2.94% gland morphogenesis
GO:0048641 2.94% regulation of skeletal muscle tissue development
GO:0030198 2.94% extracellular matrix organization
GO:0006796 2.93% phosphate-containing compound metabolic process
GO:0030855 2.93% epithelial cell differentiation
GO:0048729 2.92% tissue morphogenesis
GO:0051100 2.92% negative regulation of binding
GO:0140352 2.91% export from cell
GO:1901576 2.91% organic substance biosynthetic process
GO:0071479 2.91% cellular response to ionizing radiation
GO:0055090 2.90% acylglycerol homeostasis
GO:0010714 2.90% positive regulation of collagen metabolic process
GO:1902369 2.90% negative regulation of RNA catabolic process
GO:0045923 2.90% positive regulation of fatty acid metabolic process
GO:0048568 2.89% embryonic organ development
GO:0008306 2.89% associative learning
GO:0036230 2.88% granulocyte activation
GO:0002637 2.88% regulation of immunoglobulin production
GO:0062014 2.87% negative regulation of small molecule metabolic process
GO:0043123 2.87% positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0070328 2.87% triglyceride homeostasis
GO:0007389 2.86% pattern specification process
GO:0099537 2.86% trans-synaptic signaling
GO:0071230 2.86% cellular response to amino acid stimulus
GO:0050777 2.85% negative regulation of immune response
GO:0043032 2.85% positive regulation of macrophage activation
GO:0042330 2.85% taxis
GO:1903672 2.85% positive regulation of sprouting angiogenesis
GO:0019722 2.84% calcium-mediated signaling
GO:0019439 2.83% aromatic compound catabolic process
GO:0001523 2.83% retinoid metabolic process
GO:0032653 2.83% regulation of interleukin-10 production
GO:0008340 2.82% determination of adult lifespan
GO:0010822 2.81% positive regulation of mitochondrion organization
GO:0046686 2.81% response to cadmium ion
GO:0051289 2.80% protein homotetramerization
GO:0007268 2.80% chemical synaptic transmission
GO:0044265 2.80% cellular macromolecule catabolic process
GO:0048598 2.80% embryonic morphogenesis
GO:0051259 2.79% protein complex oligomerization
GO:0043271 2.79% negative regulation of ion transport
GO:0090200 2.79% positive regulation of release of cytochrome c from mitochondria
GO:0051050 2.79% positive regulation of transport
GO:0061041 2.78% regulation of wound healing
GO:1901361 2.78% organic cyclic compound catabolic process
GO:0015850 2.77% organic hydroxy compound transport
GO:0007608 2.76% sensory perception of smell
GO:0042417 2.76% dopamine metabolic process
GO:0045646 2.76% regulation of erythrocyte differentiation
GO:0007399 2.76% nervous system development
GO:1990830 2.75% cellular response to leukemia inhibitory factor
GO:0070661 2.75% leukocyte proliferation
GO:0042136 2.75% neurotransmitter biosynthetic process
GO:0032990 2.75% cell part morphogenesis
GO:0034369 2.75% plasma lipoprotein particle remodeling
GO:0045892 2.75% negative regulation of transcription, DNA-templated
GO:1903507 2.74% negative regulation of nucleic acid-templated transcription
GO:0045454 2.74% cell redox homeostasis
GO:0050776 2.74% regulation of immune response
GO:0009629 2.74% response to gravity
GO:0006120 2.74% mitochondrial electron transport, NADH to ubiquinone
GO:1903427 2.73% negative regulation of reactive oxygen species biosynthetic process
GO:1902679 2.73% negative regulation of RNA biosynthetic process
GO:0032733 2.73% positive regulation of interleukin-10 production
GO:0001505 2.73% regulation of neurotransmitter levels
GO:0006869 2.73% lipid transport
GO:2001238 2.72% positive regulation of extrinsic apoptotic signaling pathway
GO:0000902 2.72% cell morphogenesis
GO:0009303 2.72% rRNA transcription
GO:1900015 2.72% regulation of cytokine production involved in inflammatory response
GO:0050864 2.72% regulation of B cell activation
GO:0032526 2.72% response to retinoic acid
GO:0008630 2.71% intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902692 2.71% regulation of neuroblast proliferation
GO:0016101 2.71% diterpenoid metabolic process
GO:1901362 2.71% organic cyclic compound biosynthetic process
GO:0010224 2.70% response to UV-B
GO:0001701 2.70% in utero embryonic development
GO:0097164 2.70% ammonium ion metabolic process
GO:0071331 2.68% cellular response to hexose stimulus
GO:0033108 2.68% mitochondrial respiratory chain complex assembly
GO:0010595 2.68% positive regulation of endothelial cell migration
GO:0016485 2.68% protein processing
GO:0051604 2.68% protein maturation
GO:0070633 2.67% transepithelial transport
GO:0032651 2.67% regulation of interleukin-1 beta production
GO:0032570 2.67% response to progesterone
GO:0071772 2.66% response to BMP
GO:0006811 2.66% ion transport
GO:0071825 2.66% protein-lipid complex subunit organization
GO:0043470 2.65% regulation of carbohydrate catabolic process
GO:0007595 2.64% lactation
GO:0060627 2.64% regulation of vesicle-mediated transport
GO:0051641 2.64% cellular localization
GO:0099536 2.64% synaptic signaling
GO:0016071 2.64% mRNA metabolic process
GO:0061077 2.64% chaperone-mediated protein folding
GO:0044281 2.64% small molecule metabolic process
GO:0071773 2.63% cellular response to BMP stimulus
GO:0042113 2.63% B cell activation
GO:0051258 2.63% protein polymerization
GO:0051055 2.63% negative regulation of lipid biosynthetic process
GO:0044270 2.63% cellular nitrogen compound catabolic process
GO:1903362 2.63% regulation of cellular protein catabolic process
GO:0045577 2.63% regulation of B cell differentiation
GO:0034367 2.63% protein-containing complex remodeling
GO:1903426 2.63% regulation of reactive oxygen species biosynthetic process
GO:0007613 2.62% memory
GO:0030155 2.62% regulation of cell adhesion
GO:0050900 2.62% leukocyte migration
GO:0071326 2.62% cellular response to monosaccharide stimulus
GO:0032967 2.62% positive regulation of collagen biosynthetic process
GO:0006401 2.61% RNA catabolic process
GO:0033344 2.61% cholesterol efflux
GO:0050873 2.61% brown fat cell differentiation
GO:0043122 2.61% regulation of I-kappaB kinase/NF-kappaB signaling
GO:1901565 2.60% organonitrogen compound catabolic process
GO:2001020 2.60% regulation of response to DNA damage stimulus
GO:2000027 2.60% regulation of animal organ morphogenesis
GO:0006935 2.59% chemotaxis
GO:0023061 2.59% signal release
GO:0048582 2.58% positive regulation of post-embryonic development
GO:0051147 2.58% regulation of muscle cell differentiation
GO:0051053 2.58% negative regulation of DNA metabolic process
GO:0050807 2.58% regulation of synapse organization
GO:0065005 2.58% protein-lipid complex assembly
GO:1901861 2.57% regulation of muscle tissue development
GO:0002262 2.57% myeloid cell homeostasis
GO:0030308 2.56% negative regulation of cell growth
GO:0002227 2.56% innate immune response in mucosa
GO:0044271 2.55% cellular nitrogen compound biosynthetic process
GO:2000378 2.55% negative regulation of reactive oxygen species metabolic process
GO:0040017 2.55% positive regulation of locomotion
GO:0019827 2.54% stem cell population maintenance
GO:0043603 2.54% cellular amide metabolic process
GO:0019217 2.54% regulation of fatty acid metabolic process
GO:0045912 2.54% negative regulation of carbohydrate metabolic process
GO:0044267 2.54% cellular protein metabolic process
GO:0046700 2.54% heterocycle catabolic process
GO:0051705 2.54% multi-organism behavior
GO:0002573 2.53% myeloid leukocyte differentiation
GO:0010594 2.53% regulation of endothelial cell migration
GO:0098609 2.53% cell-cell adhesion
GO:0045475 2.53% locomotor rhythm
GO:0002673 2.53% regulation of acute inflammatory response
GO:0019748 2.52% secondary metabolic process
GO:1905332 2.52% positive regulation of morphogenesis of an epithelium
GO:0030431 2.51% sleep
GO:0001562 2.51% response to protozoan
GO:0045995 2.51% regulation of embryonic development
GO:0009057 2.50% macromolecule catabolic process
GO:0048873 2.50% homeostasis of number of cells within a tissue
GO:0045663 2.50% positive regulation of myoblast differentiation
GO:0002763 2.50% positive regulation of myeloid leukocyte differentiation
GO:0006936 2.50% muscle contraction
GO:0043567 2.50% regulation of insulin-like growth factor receptor signaling pathway
GO:0002385 2.49% mucosal immune response
GO:0071363 2.49% cellular response to growth factor stimulus
GO:0002009 2.49% morphogenesis of an epithelium
GO:0010939 2.49% regulation of necrotic cell death
GO:0050801 2.49% ion homeostasis
GO:2000147 2.48% positive regulation of cell motility
GO:0032652 2.48% regulation of interleukin-1 production
GO:0032418 2.48% lysosome localization
GO:0072332 2.47% intrinsic apoptotic signaling pathway by p53 class mediator
GO:0006383 2.47% transcription by RNA polymerase III
GO:0030183 2.47% B cell differentiation
GO:0030888 2.47% regulation of B cell proliferation
GO:0006720 2.47% isoprenoid metabolic process
GO:0090199 2.46% regulation of release of cytochrome c from mitochondria
GO:0009744 2.46% response to sucrose
GO:0006099 2.45% tricarboxylic acid cycle
GO:0097327 2.45% response to antineoplastic agent
GO:1903578 2.45% regulation of ATP metabolic process
GO:0030335 2.45% positive regulation of cell migration
GO:0045670 2.45% regulation of osteoclast differentiation
GO:0097306 2.45% cellular response to alcohol
GO:0034660 2.44% ncRNA metabolic process
GO:0071392 2.44% cellular response to estradiol stimulus
GO:0001570 2.44% vasculogenesis
GO:0048563 2.44% post-embryonic animal organ morphogenesis
GO:0003018 2.44% vascular process in circulatory system
GO:0045682 2.44% regulation of epidermis development
GO:0050871 2.43% positive regulation of B cell activation
GO:1903580 2.42% positive regulation of ATP metabolic process
GO:0006140 2.42% regulation of nucleotide metabolic process
GO:0048538 2.42% thymus development
GO:0070925 2.42% organelle assembly
GO:1900542 2.42% regulation of purine nucleotide metabolic process
GO:0022402 2.42% cell cycle process
GO:2001242 2.41% regulation of intrinsic apoptotic signaling pathway
GO:1903707 2.41% negative regulation of hemopoiesis
GO:0002831 2.41% regulation of response to biotic stimulus
GO:0030301 2.41% cholesterol transport
GO:1902106 2.41% negative regulation of leukocyte differentiation
GO:0003254 2.41% regulation of membrane depolarization
GO:0018130 2.41% heterocycle biosynthetic process
GO:0050778 2.41% positive regulation of immune response
GO:0050920 2.41% regulation of chemotaxis
GO:1900120 2.41% regulation of receptor binding
GO:0042304 2.40% regulation of fatty acid biosynthetic process
GO:0071384 2.40% cellular response to corticosteroid stimulus
GO:0071674 2.40% mononuclear cell migration
GO:0000003 2.39% reproduction
GO:0045165 2.39% cell fate commitment
GO:0071705 2.39% nitrogen compound transport
GO:0090257 2.38% regulation of muscle system process
GO:0002861 2.38% regulation of inflammatory response to antigenic stimulus
GO:0030330 2.37% DNA damage response, signal transduction by p53 class mediator
GO:0010001 2.37% glial cell differentiation
GO:0048754 2.37% branching morphogenesis of an epithelial tube
GO:0051402 2.36% neuron apoptotic process
GO:0007168 2.36% receptor guanylyl cyclase signaling pathway
GO:0051216 2.36% cartilage development
GO:0001649 2.36% osteoblast differentiation
GO:0090398 2.36% cellular senescence
GO:0016202 2.36% regulation of striated muscle tissue development
GO:0022411 2.35% cellular component disassembly
GO:0006259 2.35% DNA metabolic process
GO:0008543 2.35% fibroblast growth factor receptor signaling pathway
GO:2000106 2.35% regulation of leukocyte apoptotic process
GO:0097485 2.34% neuron projection guidance
GO:0097722 2.34% sperm motility
GO:1990823 2.34% response to leukemia inhibitory factor
GO:0071383 2.34% cellular response to steroid hormone stimulus
GO:2000058 2.34% regulation of ubiquitin-dependent protein catabolic process
GO:1902117 2.33% positive regulation of organelle assembly
GO:0006518 2.33% peptide metabolic process
GO:0035265 2.32% organ growth
GO:0030101 2.32% natural killer cell activation
GO:0050905 2.32% neuromuscular process
GO:0034661 2.32% ncRNA catabolic process
GO:1901653 2.32% cellular response to peptide
GO:0051272 2.32% positive regulation of cellular component movement
GO:0016192 2.31% vesicle-mediated transport
GO:0010743 2.31% regulation of macrophage derived foam cell differentiation
GO:0071241 2.31% cellular response to inorganic substance
GO:0048562 2.31% embryonic organ morphogenesis
GO:1903036 2.31% positive regulation of response to wounding
GO:0002065 2.31% columnar/cuboidal epithelial cell differentiation
GO:0060285 2.30% cilium-dependent cell motility
GO:0098727 2.30% maintenance of cell number
GO:2001244 2.30% positive regulation of intrinsic apoptotic signaling pathway
GO:0030857 2.30% negative regulation of epithelial cell differentiation
GO:0003002 2.30% regionalization
GO:0071385 2.30% cellular response to glucocorticoid stimulus
GO:0045913 2.29% positive regulation of carbohydrate metabolic process
GO:1905952 2.29% regulation of lipid localization
GO:0007006 2.28% mitochondrial membrane organization
GO:0035150 2.28% regulation of tube size
GO:1905954 2.28% positive regulation of lipid localization
GO:0042110 2.28% T cell activation
GO:0032943 2.28% mononuclear cell proliferation
GO:0060261 2.28% positive regulation of transcription initiation from RNA polymerase II promoter
GO:0071548 2.28% response to dexamethasone
GO:0046651 2.28% lymphocyte proliferation
GO:0045600 2.27% positive regulation of fat cell differentiation
GO:0048634 2.27% regulation of muscle organ development
GO:0019932 2.26% second-messenger-mediated signaling
GO:0008347 2.26% glial cell migration
GO:0002437 2.26% inflammatory response to antigenic stimulus
GO:0045742 2.26% positive regulation of epidermal growth factor receptor signaling pathway
GO:0090303 2.26% positive regulation of wound healing
GO:0042552 2.25% myelination
GO:0007015 2.25% actin filament organization
GO:0010770 2.25% positive regulation of cell morphogenesis involved in differentiation
GO:0009712 2.25% catechol-containing compound metabolic process
GO:0019438 2.25% aromatic compound biosynthetic process
GO:0071320 2.24% cellular response to cAMP
GO:0071774 2.24% response to fibroblast growth factor
GO:0010830 2.24% regulation of myotube differentiation
GO:0046148 2.24% pigment biosynthetic process
GO:0002548 2.24% monocyte chemotaxis
GO:0051640 2.23% organelle localization
GO:0034285 2.23% response to disaccharide
GO:0010721 2.23% negative regulation of cell development
GO:0051262 2.23% protein tetramerization
GO:1901186 2.22% positive regulation of ERBB signaling pathway
GO:0051926 2.22% negative regulation of calcium ion transport
GO:0007411 2.22% axon guidance
GO:0010665 2.22% regulation of cardiac muscle cell apoptotic process
GO:0000904 2.22% cell morphogenesis involved in differentiation
GO:0097028 2.22% dendritic cell differentiation
GO:0110110 2.21% positive regulation of animal organ morphogenesis
GO:0042755 2.20% eating behavior
GO:0051656 2.20% establishment of organelle localization
GO:0010469 2.20% regulation of signaling receptor activity
GO:1903725 2.20% regulation of phospholipid metabolic process
GO:0008202 2.20% steroid metabolic process
GO:0071559 2.20% response to transforming growth factor beta
GO:0032006 2.19% regulation of TOR signaling
GO:0045776 2.19% negative regulation of blood pressure
GO:0006464 2.19% cellular protein modification process
GO:0036211 2.19% protein modification process
GO:1905330 2.19% regulation of morphogenesis of an epithelium
GO:0006575 2.19% cellular modified amino acid metabolic process
GO:0030317 2.19% flagellated sperm motility
GO:0032731 2.18% positive regulation of interleukin-1 beta production
GO:0032673 2.18% regulation of interleukin-4 production
GO:0040019 2.18% positive regulation of embryonic development
GO:0032147 2.18% activation of protein kinase activity
GO:0031333 2.18% negative regulation of protein complex assembly
GO:0042770 2.18% signal transduction in response to DNA damage
GO:1905897 2.18% regulation of response to endoplasmic reticulum stress
GO:0045936 2.17% negative regulation of phosphate metabolic process
GO:0010662 2.17% regulation of striated muscle cell apoptotic process
GO:0071902 2.17% positive regulation of protein serine/threonine kinase activity
GO:0045745 2.17% positive regulation of G protein-coupled receptor signaling pathway
GO:2001237 2.16% negative regulation of extrinsic apoptotic signaling pathway
GO:0042832 2.16% defense response to protozoan
GO:0010563 2.16% negative regulation of phosphorus metabolic process
GO:0060135 2.15% maternal process involved in female pregnancy
GO:0007259 2.15% receptor signaling pathway via JAK-STAT
GO:1901135 2.15% carbohydrate derivative metabolic process
GO:0043412 2.15% macromolecule modification
GO:0006956 2.15% complement activation
GO:0043043 2.14% peptide biosynthetic process
GO:0034645 2.14% cellular macromolecule biosynthetic process
GO:0032868 2.14% response to insulin
GO:0045662 2.14% negative regulation of myoblast differentiation
GO:0002263 2.13% cell activation involved in immune response
GO:0008366 2.13% axon ensheathment
GO:0060179 2.13% male mating behavior
GO:0007349 2.13% cellularization
GO:1901655 2.13% cellular response to ketone
GO:0006066 2.13% alcohol metabolic process
GO:1902115 2.13% regulation of organelle assembly
GO:0042133 2.13% neurotransmitter metabolic process
GO:0009648 2.13% photoperiodism
GO:0097696 2.12% receptor signaling pathway via STAT
GO:0018193 2.12% peptidyl-amino acid modification
GO:0071375 2.12% cellular response to peptide hormone stimulus
GO:0030324 2.12% lung development
GO:0042048 2.12% olfactory behavior
GO:0006396 2.11% RNA processing
GO:0046907 2.11% intracellular transport
GO:0046486 2.11% glycerolipid metabolic process
GO:0007010 2.11% cytoskeleton organization
GO:0032535 2.11% regulation of cellular component size
GO:0006584 2.11% catecholamine metabolic process
GO:0061900 2.11% glial cell activation
GO:0009651 2.11% response to salt stress
GO:0032732 2.11% positive regulation of interleukin-1 production
GO:0046902 2.10% regulation of mitochondrial membrane permeability
GO:0002685 2.10% regulation of leukocyte migration
GO:0090183 2.10% regulation of kidney development
GO:0030522 2.10% intracellular receptor signaling pathway
GO:0045444 2.10% fat cell differentiation
GO:1902107 2.10% positive regulation of leukocyte differentiation
GO:0050869 2.10% negative regulation of B cell activation
GO:0001890 2.10% placenta development
GO:0043269 2.09% regulation of ion transport
GO:1901992 2.09% positive regulation of mitotic cell cycle phase transition
GO:0010661 2.09% positive regulation of muscle cell apoptotic process
GO:0035239 2.09% tube morphogenesis
GO:0045648 2.09% positive regulation of erythrocyte differentiation
GO:0006412 2.08% translation
GO:0009060 2.08% aerobic respiration
GO:0016050 2.08% vesicle organization
GO:0051447 2.07% negative regulation of meiotic cell cycle
GO:0008037 2.07% cell recognition
GO:0060759 2.07% regulation of response to cytokine stimulus
GO:0044550 2.07% secondary metabolite biosynthetic process
GO:0097529 2.07% myeloid leukocyte migration
GO:0007179 2.07% transforming growth factor beta receptor signaling pathway
GO:0035296 2.07% regulation of tube diameter
GO:1905523 2.06% positive regulation of macrophage migration
GO:0030510 2.06% regulation of BMP signaling pathway
GO:0035108 2.06% limb morphogenesis
GO:0070670 2.06% response to interleukin-4
GO:0007548 2.06% sex differentiation
GO:0006801 2.06% superoxide metabolic process
GO:0045835 2.06% negative regulation of meiotic nuclear division
GO:0030595 2.06% leukocyte chemotaxis
GO:0001708 2.05% cell fate specification
GO:0048662 2.05% negative regulation of smooth muscle cell proliferation
GO:0021954 2.05% central nervous system neuron development
GO:1901988 2.05% negative regulation of cell cycle phase transition
GO:0006790 2.05% sulfur compound metabolic process
GO:0001937 2.05% negative regulation of endothelial cell proliferation
GO:0009059 2.05% macromolecule biosynthetic process
GO:0002790 2.04% peptide secretion
GO:0035107 2.04% appendage morphogenesis
GO:0017015 2.04% regulation of transforming growth factor beta receptor signaling pathway
GO:0055081 2.04% anion homeostasis
GO:0045576 2.04% mast cell activation
GO:0015918 2.03% sterol transport
GO:0008286 2.03% insulin receptor signaling pathway
GO:0090184 2.02% positive regulation of kidney development
GO:0030435 2.02% sporulation resulting in formation of a cellular spore
GO:0008154 2.02% actin polymerization or depolymerization
GO:0009886 2.02% post-embryonic animal morphogenesis
GO:0007507 2.02% heart development
GO:0007272 2.02% ensheathment of neurons
GO:0042446 2.02% hormone biosynthetic process
GO:0045638 2.02% negative regulation of myeloid cell differentiation
GO:0097746 2.01% regulation of blood vessel diameter
GO:0043154 2.01% negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0046885 2.01% regulation of hormone biosynthetic process
GO:0032434 2.01% regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0110149 2.01% regulation of biomineralization
GO:0010043 2.01% response to zinc ion
GO:2001021 2.01% negative regulation of response to DNA damage stimulus
GO:0071467 2.01% cellular response to pH
GO:0030901 2.00% midbrain development
GO:0046034 2.00% ATP metabolic process
GO:1903050 2.00% regulation of proteolysis involved in cellular protein catabolic process
GO:0030279 2.00% negative regulation of ossification
GO:0006397 2.00% mRNA processing
GO:0042326 2.00% negative regulation of phosphorylation
GO:0051047 2.00% positive regulation of secretion
GO:0048247 1.99% lymphocyte chemotaxis
GO:0070167 1.99% regulation of biomineral tissue development
GO:0030500 1.99% regulation of bone mineralization
GO:0001755 1.99% neural crest cell migration
GO:0010508 1.99% positive regulation of autophagy
GO:0008380 1.99% RNA splicing
GO:1903530 1.99% regulation of secretion by cell
GO:0045580 1.99% regulation of T cell differentiation
GO:0010837 1.99% regulation of keratinocyte proliferation
GO:0007632 1.99% visual behavior
GO:0048661 1.98% positive regulation of smooth muscle cell proliferation
GO:0022602 1.98% ovulation cycle process
GO:0042058 1.98% regulation of epidermal growth factor receptor signaling pathway
GO:0030728 1.98% ovulation
GO:1990928 1.97% response to amino acid starvation
GO:0006631 1.97% fatty acid metabolic process
GO:1903319 1.97% positive regulation of protein maturation
GO:0006820 1.97% anion transport
GO:0034976 1.97% response to endoplasmic reticulum stress
GO:0002832 1.97% negative regulation of response to biotic stimulus
GO:0034654 1.97% nucleobase-containing compound biosynthetic process
GO:0033555 1.97% multicellular organismal response to stress
GO:0006694 1.96% steroid biosynthetic process
GO:0043903 1.96% regulation of symbiosis, encompassing mutualism through parasitism
GO:0043604 1.96% amide biosynthetic process
GO:0001776 1.96% leukocyte homeostasis
GO:0006082 1.96% organic acid metabolic process
GO:0050867 1.95% positive regulation of cell activation
GO:1903313 1.94% positive regulation of mRNA metabolic process
GO:0061062 1.94% regulation of nematode larval development
GO:0009738 1.94% abscisic acid-activated signaling pathway
GO:0009751 1.94% response to salicylic acid
GO:1901184 1.94% regulation of ERBB signaling pathway
GO:0002696 1.93% positive regulation of leukocyte activation
GO:0045785 1.93% positive regulation of cell adhesion
GO:0050922 1.93% negative regulation of chemotaxis
GO:0031139 1.93% positive regulation of conjugation with cellular fusion
GO:0050931 1.93% pigment cell differentiation
GO:0007017 1.93% microtubule-based process
GO:1901222 1.93% regulation of NIK/NF-kappaB signaling
GO:0072073 1.93% kidney epithelium development
GO:0035019 1.92% somatic stem cell population maintenance
GO:0022408 1.92% negative regulation of cell-cell adhesion
GO:0033044 1.92% regulation of chromosome organization
GO:0072521 1.92% purine-containing compound metabolic process
GO:0002833 1.92% positive regulation of response to biotic stimulus
GO:0021782 1.92% glial cell development
GO:0045604 1.92% regulation of epidermal cell differentiation
GO:0001959 1.92% regulation of cytokine-mediated signaling pathway
GO:0009644 1.92% response to high light intensity
GO:0006261 1.91% DNA-dependent DNA replication
GO:0045787 1.91% positive regulation of cell cycle
GO:0055086 1.91% nucleobase-containing small molecule metabolic process
GO:0032787 1.91% monocarboxylic acid metabolic process
GO:1902041 1.91% regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0032368 1.91% regulation of lipid transport
GO:0120163 1.91% negative regulation of cold-induced thermogenesis
GO:0010954 1.91% positive regulation of protein processing
GO:0043436 1.91% oxoacid metabolic process
GO:0071466 1.90% cellular response to xenobiotic stimulus
GO:0006812 1.90% cation transport
GO:0042632 1.90% cholesterol homeostasis
GO:0071549 1.90% cellular response to dexamethasone stimulus
GO:0010660 1.90% regulation of muscle cell apoptotic process
GO:0002052 1.90% positive regulation of neuroblast proliferation
GO:0051048 1.89% negative regulation of secretion
GO:0045932 1.89% negative regulation of muscle contraction
GO:0045185 1.89% maintenance of protein location
GO:0045667 1.89% regulation of osteoblast differentiation
GO:0043331 1.89% response to dsRNA
GO:0043299 1.89% leukocyte degranulation
GO:0008361 1.89% regulation of cell size
GO:0002703 1.89% regulation of leukocyte mediated immunity
GO:1900424 1.89% regulation of defense response to bacterium
GO:0007530 1.88% sex determination
GO:0009635 1.88% response to herbicide
GO:0009723 1.88% response to ethylene
GO:0090092 1.87% regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0060560 1.87% developmental growth involved in morphogenesis
GO:0032369 1.87% negative regulation of lipid transport
GO:0051235 1.87% maintenance of location
GO:0008542 1.87% visual learning
GO:1904035 1.87% regulation of epithelial cell apoptotic process
GO:2001243 1.87% negative regulation of intrinsic apoptotic signaling pathway
GO:0050817 1.86% coagulation
GO:0043457 1.86% regulation of cellular respiration
GO:0070269 1.86% pyroptosis
GO:0047484 1.86% regulation of response to osmotic stress
GO:0042044 1.86% fluid transport
GO:0035162 1.86% embryonic hemopoiesis
GO:0016999 1.86% antibiotic metabolic process
GO:0002366 1.86% leukocyte activation involved in immune response
GO:0018105 1.86% peptidyl-serine phosphorylation
GO:0030072 1.86% peptide hormone secretion
GO:0018212 1.86% peptidyl-tyrosine modification
GO:0034754 1.85% cellular hormone metabolic process
GO:0009793 1.85% embryo development ending in seed dormancy
GO:0052803 1.85% imidazole-containing compound metabolic process
GO:0019637 1.85% organophosphate metabolic process
GO:0045685 1.85% regulation of glial cell differentiation
GO:0006805 1.85% xenobiotic metabolic process
GO:0019752 1.85% carboxylic acid metabolic process
GO:0055082 1.84% cellular chemical homeostasis
GO:0098754 1.84% detoxification
GO:0045981 1.84% positive regulation of nucleotide metabolic process
GO:0000122 1.84% negative regulation of transcription by RNA polymerase II
GO:1903844 1.84% regulation of cellular response to transforming growth factor beta stimulus
GO:1990089 1.84% response to nerve growth factor
GO:1990090 1.83% cellular response to nerve growth factor stimulus
GO:0071560 1.83% cellular response to transforming growth factor beta stimulus
GO:1903428 1.83% positive regulation of reactive oxygen species biosynthetic process
GO:0045017 1.83% glycerolipid biosynthetic process
GO:0031136 1.83% positive regulation of conjugation
GO:0050808 1.83% synapse organization
GO:0045616 1.83% regulation of keratinocyte differentiation
GO:0043934 1.83% sporulation
GO:1903046 1.83% meiotic cell cycle process
GO:0051952 1.83% regulation of amine transport
GO:0048240 1.82% sperm capacitation
GO:0042476 1.82% odontogenesis
GO:0003014 1.82% renal system process
GO:0009798 1.81% axis specification
GO:0002687 1.81% positive regulation of leukocyte migration
GO:2000351 1.81% regulation of endothelial cell apoptotic process
GO:0055065 1.81% metal ion homeostasis
GO:0015748 1.80% organophosphate ester transport
GO:0018108 1.80% peptidyl-tyrosine phosphorylation
GO:0050909 1.80% sensory perception of taste
GO:1902742 1.80% apoptotic process involved in development
GO:1902230 1.80% negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902074 1.80% response to salt
GO:1905809 1.80% negative regulation of synapse organization
GO:0002690 1.79% positive regulation of leukocyte chemotaxis
GO:1901989 1.79% positive regulation of cell cycle phase transition
GO:0051445 1.79% regulation of meiotic cell cycle
GO:0007635 1.79% chemosensory behavior
GO:0050996 1.79% positive regulation of lipid catabolic process
GO:0032880 1.78% regulation of protein localization
GO:2001022 1.78% positive regulation of response to DNA damage stimulus
GO:0002886 1.78% regulation of myeloid leukocyte mediated immunity
GO:1990748 1.78% cellular detoxification
GO:0002119 1.78% nematode larval development
GO:1903727 1.78% positive regulation of phospholipid metabolic process
GO:0007162 1.78% negative regulation of cell adhesion
GO:0007064 1.78% mitotic sister chromatid cohesion
GO:0044058 1.77% regulation of digestive system process
GO:0010470 1.77% regulation of gastrulation
GO:0072347 1.77% response to anesthetic
GO:0009268 1.77% response to pH
GO:0002260 1.77% lymphocyte homeostasis
GO:0032386 1.77% regulation of intracellular transport
GO:0051099 1.77% positive regulation of binding
GO:0034405 1.77% response to fluid shear stress
GO:0071248 1.77% cellular response to metal ion
GO:0002688 1.77% regulation of leukocyte chemotaxis
GO:0043029 1.77% T cell homeostasis
GO:1904037 1.77% positive regulation of epithelial cell apoptotic process
GO:0006110 1.76% regulation of glycolytic process
GO:0032649 1.76% regulation of interferon-gamma production
GO:0035094 1.76% response to nicotine
GO:0071887 1.76% leukocyte apoptotic process
GO:0090087 1.76% regulation of peptide transport
GO:0051954 1.76% positive regulation of amine transport
GO:0048048 1.76% embryonic eye morphogenesis
GO:0006937 1.75% regulation of muscle contraction
GO:0070664 1.75% negative regulation of leukocyte proliferation
GO:1900544 1.75% positive regulation of purine nucleotide metabolic process
GO:0022407 1.75% regulation of cell-cell adhesion
GO:0006633 1.75% fatty acid biosynthetic process
GO:0060326 1.75% cell chemotaxis
GO:0003015 1.74% heart process
GO:0045721 1.74% negative regulation of gluconeogenesis
GO:2000179 1.74% positive regulation of neural precursor cell proliferation
GO:0006353 1.74% DNA-templated transcription, termination
GO:0061136 1.74% regulation of proteasomal protein catabolic process
GO:0051249 1.74% regulation of lymphocyte activation
GO:1900371 1.74% regulation of purine nucleotide biosynthetic process
GO:0051150 1.74% regulation of smooth muscle cell differentiation
GO:0001658 1.74% branching involved in ureteric bud morphogenesis
GO:0050921 1.74% positive regulation of chemotaxis
GO:0055092 1.74% sterol homeostasis
GO:0098771 1.74% inorganic ion homeostasis
GO:0034050 1.73% host programmed cell death induced by symbiont
GO:1902807 1.73% negative regulation of cell cycle G1/S phase transition
GO:0048525 1.73% negative regulation of viral process
GO:0043550 1.73% regulation of lipid kinase activity
GO:0097530 1.73% granulocyte migration
GO:0046883 1.73% regulation of hormone secretion
GO:0030041 1.73% actin filament polymerization
GO:0090069 1.72% regulation of ribosome biogenesis
GO:0050863 1.72% regulation of T cell activation
GO:0016042 1.72% lipid catabolic process
GO:0060260 1.72% regulation of transcription initiation from RNA polymerase II promoter
GO:0051961 1.72% negative regulation of nervous system development
GO:0034613 1.72% cellular protein localization
GO:0072330 1.72% monocarboxylic acid biosynthetic process
GO:0009117 1.72% nucleotide metabolic process
GO:0051603 1.72% proteolysis involved in cellular protein catabolic process
GO:0008156 1.72% negative regulation of DNA replication
GO:0007205 1.72% protein kinase C-activating G protein-coupled receptor signaling pathway
GO:0001539 1.72% cilium or flagellum-dependent cell motility
GO:0060341 1.71% regulation of cellular localization
GO:0002164 1.71% larval development
GO:0045732 1.71% positive regulation of protein catabolic process
GO:0035113 1.71% embryonic appendage morphogenesis
GO:0006753 1.71% nucleoside phosphate metabolic process
GO:0051703 1.70% intraspecies interaction between organisms
GO:0032689 1.70% negative regulation of interferon-gamma production
GO:0019646 1.70% aerobic electron transport chain
GO:0007409 1.70% axonogenesis
GO:0007292 1.70% female gamete generation
GO:0046999 1.70% regulation of conjugation
GO:1901796 1.70% regulation of signal transduction by p53 class mediator
GO:0008104 1.70% protein localization
GO:0090279 1.70% regulation of calcium ion import
GO:0010631 1.70% epithelial cell migration
GO:0006281 1.69% DNA repair
GO:0033036 1.69% macromolecule localization
GO:0006310 1.69% DNA recombination
GO:1901216 1.69% positive regulation of neuron death
GO:0031137 1.69% regulation of conjugation with cellular fusion
GO:0070663 1.69% regulation of leukocyte proliferation
GO:0050772 1.69% positive regulation of axonogenesis
GO:0030705 1.69% cytoskeleton-dependent intracellular transport
GO:0060415 1.69% muscle tissue morphogenesis
GO:0030217 1.69% T cell differentiation
GO:0003156 1.69% regulation of animal organ formation
GO:0015711 1.69% organic anion transport
GO:0042886 1.69% amide transport
GO:0050821 1.69% protein stabilization
GO:0070169 1.68% positive regulation of biomineral tissue development
GO:0043525 1.68% positive regulation of neuron apoptotic process
GO:0032370 1.68% positive regulation of lipid transport
GO:0002253 1.68% activation of immune response
GO:0033013 1.68% tetrapyrrole metabolic process
GO:0071300 1.67% cellular response to retinoic acid
GO:0007596 1.67% blood coagulation
GO:0014013 1.67% regulation of gliogenesis
GO:0070727 1.67% cellular macromolecule localization
GO:1903798 1.67% regulation of production of miRNAs involved in gene silencing by miRNA
GO:0055080 1.67% cation homeostasis
GO:0051153 1.67% regulation of striated muscle cell differentiation
GO:0019236 1.67% response to pheromone
GO:0001501 1.66% skeletal system development
GO:0070570 1.66% regulation of neuron projection regeneration
GO:0008582 1.66% regulation of synaptic growth at neuromuscular junction
GO:0015833 1.66% peptide transport
GO:0010799 1.66% regulation of peptidyl-threonine phosphorylation
GO:0032922 1.66% circadian regulation of gene expression
GO:0009734 1.66% auxin-activated signaling pathway
GO:0090693 1.66% plant organ senescence
GO:2000144 1.66% positive regulation of DNA-templated transcription, initiation
GO:0032660 1.65% regulation of interleukin-17 production
GO:1901890 1.65% positive regulation of cell junction assembly
GO:0010498 1.65% proteasomal protein catabolic process
GO:0007178 1.65% transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051149 1.65% positive regulation of muscle cell differentiation
GO:0043551 1.65% regulation of phosphatidylinositol 3-kinase activity
GO:0046621 1.65% negative regulation of organ growth
GO:0002312 1.64% B cell activation involved in immune response
GO:1903047 1.64% mitotic cell cycle process
GO:0120039 1.64% plasma membrane bounded cell projection morphogenesis
GO:0032543 1.64% mitochondrial translation
GO:1903670 1.64% regulation of sprouting angiogenesis
GO:2000279 1.63% negative regulation of DNA biosynthetic process
GO:1905820 1.63% positive regulation of chromosome separation
GO:0009259 1.63% ribonucleotide metabolic process
GO:0032092 1.63% positive regulation of protein binding
GO:0030111 1.63% regulation of Wnt signaling pathway
GO:0007249 1.63% I-kappaB kinase/NF-kappaB signaling
GO:0009787 1.62% regulation of abscisic acid-activated signaling pathway
GO:0002275 1.62% myeloid cell activation involved in immune response
GO:0043502 1.62% regulation of muscle adaptation
GO:0002675 1.62% positive regulation of acute inflammatory response
GO:0055072 1.62% iron ion homeostasis
GO:0033120 1.62% positive regulation of RNA splicing
GO:1903531 1.61% negative regulation of secretion by cell
GO:0110151 1.61% positive regulation of biomineralization
GO:0046697 1.61% decidualization
GO:0048812 1.61% neuron projection morphogenesis
GO:0050433 1.61% regulation of catecholamine secretion
GO:0001960 1.61% negative regulation of cytokine-mediated signaling pathway
GO:0071675 1.61% regulation of mononuclear cell migration
GO:0003085 1.61% negative regulation of systemic arterial blood pressure
GO:0033238 1.61% regulation of cellular amine metabolic process
GO:0002269 1.61% leukocyte activation involved in inflammatory response
GO:0006638 1.61% neutral lipid metabolic process
GO:0060760 1.60% positive regulation of response to cytokine stimulus
GO:0140013 1.60% meiotic nuclear division
GO:1905710 1.60% positive regulation of membrane permeability
GO:0045669 1.59% positive regulation of osteoblast differentiation
GO:0045599 1.59% negative regulation of fat cell differentiation
GO:0010150 1.59% leaf senescence
GO:0007599 1.59% hemostasis
GO:0030029 1.59% actin filament-based process
GO:1905957 1.59% regulation of cellular response to alcohol
GO:0043588 1.59% skin development
GO:0060148 1.59% positive regulation of posttranscriptional gene silencing
GO:0043542 1.59% endothelial cell migration
GO:0042069 1.59% regulation of catecholamine metabolic process
GO:0042771 1.59% intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0051321 1.58% meiotic cell cycle
GO:0032350 1.58% regulation of hormone metabolic process
GO:0006163 1.58% purine nucleotide metabolic process
GO:0002931 1.58% response to ischemia
GO:2000178 1.57% negative regulation of neural precursor cell proliferation
GO:0050768 1.57% negative regulation of neurogenesis
GO:0046470 1.57% phosphatidylcholine metabolic process
GO:0051602 1.57% response to electrical stimulus
GO:0009415 1.57% response to water
GO:1903364 1.57% positive regulation of cellular protein catabolic process
GO:1900078 1.57% positive regulation of cellular response to insulin stimulus
GO:0048858 1.57% cell projection morphogenesis
GO:0002360 1.56% T cell lineage commitment
GO:0098869 1.56% cellular oxidant detoxification
GO:0046330 1.56% positive regulation of JNK cascade
GO:2000134 1.56% negative regulation of G1/S transition of mitotic cell cycle
GO:0009309 1.56% amine biosynthetic process
GO:1902253 1.56% regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:1905879 1.56% regulation of oogenesis
GO:0070417 1.56% cellular response to cold
GO:0022617 1.56% extracellular matrix disassembly
GO:1904019 1.56% epithelial cell apoptotic process
GO:0014031 1.56% mesenchymal cell development
GO:0045778 1.56% positive regulation of ossification
GO:0070201 1.56% regulation of establishment of protein localization
GO:0044283 1.56% small molecule biosynthetic process
GO:0048831 1.56% regulation of shoot system development
GO:0043278 1.55% response to morphine
GO:2000107 1.55% negative regulation of leukocyte apoptotic process
GO:0060070 1.55% canonical Wnt signaling pathway
GO:1904705 1.55% regulation of vascular smooth muscle cell proliferation
GO:0009737 1.55% response to abscisic acid
GO:0019724 1.55% B cell mediated immunity
GO:0006308 1.55% DNA catabolic process
GO:0072676 1.55% lymphocyte migration
GO:1901566 1.55% organonitrogen compound biosynthetic process
GO:0001952 1.55% regulation of cell-matrix adhesion
GO:0002762 1.55% negative regulation of myeloid leukocyte differentiation
GO:0030437 1.55% ascospore formation
GO:0022413 1.54% reproductive process in single-celled organism
GO:0043935 1.54% sexual sporulation resulting in formation of a cellular spore
GO:0014910 1.54% regulation of smooth muscle cell migration
GO:0015893 1.54% drug transport
GO:0098801 1.54% regulation of renal system process
GO:0002082 1.54% regulation of oxidative phosphorylation
GO:0030514 1.54% negative regulation of BMP signaling pathway
GO:0032735 1.54% positive regulation of interleukin-12 production
GO:0042475 1.54% odontogenesis of dentin-containing tooth
GO:0030326 1.53% embryonic limb morphogenesis
GO:0006949 1.53% syncytium formation
GO:0007614 1.53% short-term memory
GO:0031638 1.53% zymogen activation
GO:0010827 1.53% regulation of glucose transmembrane transport
GO:0051898 1.53% negative regulation of protein kinase B signaling
GO:0043114 1.53% regulation of vascular permeability
GO:0009150 1.53% purine ribonucleotide metabolic process
GO:0045736 1.53% negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0016075 1.53% rRNA catabolic process
GO:0006144 1.53% purine nucleobase metabolic process
GO:0042401 1.53% cellular biogenic amine biosynthetic process
GO:0043161 1.52% proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0042130 1.52% negative regulation of T cell proliferation
GO:0003382 1.52% epithelial cell morphogenesis
GO:0010769 1.52% regulation of cell morphogenesis involved in differentiation
GO:0030808 1.52% regulation of nucleotide biosynthetic process
GO:0042246 1.52% tissue regeneration
GO:0014015 1.52% positive regulation of gliogenesis
GO:0050672 1.52% negative regulation of lymphocyte proliferation
GO:0001774 1.51% microglial cell activation
GO:0060251 1.51% regulation of glial cell proliferation
GO:2000024 1.51% regulation of leaf development
GO:0001933 1.51% negative regulation of protein phosphorylation
GO:0007018 1.51% microtubule-based movement
GO:0032655 1.51% regulation of interleukin-12 production
GO:0030048 1.51% actin filament-based movement
GO:0090090 1.51% negative regulation of canonical Wnt signaling pathway
GO:0043087 1.51% regulation of GTPase activity
GO:0043536 1.51% positive regulation of blood vessel endothelial cell migration
GO:0009867 1.51% jasmonic acid mediated signaling pathway
GO:0043489 1.51% RNA stabilization
GO:0090322 1.51% regulation of superoxide metabolic process
GO:0071402 1.51% cellular response to lipoprotein particle stimulus
GO:0006260 1.50% DNA replication
GO:0050892 1.50% intestinal absorption
GO:0042026 1.50% protein refolding
GO:1901419 1.50% regulation of response to alcohol
GO:0050918 1.50% positive chemotaxis
GO:0002791 1.50% regulation of peptide secretion
GO:0040034 1.50% regulation of development, heterochronic
GO:0030163 1.50% protein catabolic process
GO:0061919 1.50% process utilizing autophagic mechanism
GO:0007264 1.50% small GTPase mediated signal transduction
GO:0006399 1.50% tRNA metabolic process
GO:0043406 1.50% positive regulation of MAP kinase activity
GO:1904396 1.50% regulation of neuromuscular junction development
GO:0048705 1.50% skeletal system morphogenesis
GO:0016036 1.50% cellular response to phosphate starvation
GO:0032872 1.50% regulation of stress-activated MAPK cascade
GO:0016032 1.49% viral process
GO:0007193 1.49% adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0090025 1.49% regulation of monocyte chemotaxis
GO:0002698 1.49% negative regulation of immune effector process
GO:0045824 1.49% negative regulation of innate immune response
GO:0002712 1.49% regulation of B cell mediated immunity
GO:0033003 1.48% regulation of mast cell activation
GO:0019934 1.48% cGMP-mediated signaling
GO:0010171 1.48% body morphogenesis
GO:0046320 1.48% regulation of fatty acid oxidation
GO:0007616 1.48% long-term memory
GO:0071731 1.48% response to nitric oxide
GO:0048679 1.48% response to isoquinoline alkaloid
GO:0014072 1.48% regulation of axon regeneration
GO:0042737 1.48% drug catabolic process
GO:0044062 1.48% regulation of excretion
GO:0016072 1.48% rRNA metabolic process
GO:0045428 1.48% regulation of nitric oxide biosynthetic process
GO:0051984 1.48% positive regulation of chromosome segregation
GO:0002686 1.48% negative regulation of leukocyte migration
GO:1902229 1.48% regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009626 1.48% plant-type hypersensitive response
GO:0001773 1.47% myeloid dendritic cell activation
GO:0042692 1.47% muscle cell differentiation
GO:0006639 1.47% acylglycerol metabolic process
GO:0055010 1.47% ventricular cardiac muscle tissue morphogenesis
GO:0031016 1.47% pancreas development
GO:0097066 1.47% response to thyroid hormone
GO:0006123 1.47% mitochondrial electron transport, cytochrome c to oxygen
GO:0048536 1.47% spleen development
GO:0003007 1.47% heart morphogenesis
GO:0017157 1.46% regulation of exocytosis
GO:0007140 1.46% male meiotic nuclear division
GO:0060142 1.46% regulation of syncytium formation by plasma membrane fusion
GO:0046626 1.46% regulation of insulin receptor signaling pathway
GO:2001025 1.46% positive regulation of response to drug
GO:0032945 1.46% negative regulation of mononuclear cell proliferation
GO:0046068 1.46% cGMP metabolic process
GO:0051101 1.46% regulation of DNA binding
GO:0070373 1.46% negative regulation of ERK1 and ERK2 cascade
GO:0048839 1.46% inner ear development
GO:0060390 1.46% regulation of SMAD protein signal transduction
GO:1900182 1.46% positive regulation of protein localization to nucleus
GO:1905953 1.46% negative regulation of lipid localization
GO:1901136 1.46% carbohydrate derivative catabolic process
GO:0010042 1.46% response to manganese ion
GO:0006972 1.46% hyperosmotic response
GO:0043516 1.46% regulation of DNA damage response, signal transduction by p53 class mediator
GO:0032007 1.46% negative regulation of TOR signaling
GO:0010831 1.45% positive regulation of myotube differentiation
GO:0070302 1.45% regulation of stress-activated protein kinase signaling cascade
GO:0042116 1.45% macrophage activation
GO:0071353 1.45% cellular response to interleukin-4
GO:0001764 1.45% neuron migration
GO:1903573 1.45% negative regulation of response to endoplasmic reticulum stress
GO:0006662 1.44% glycerol ether metabolic process
GO:0051148 1.44% negative regulation of muscle cell differentiation
GO:1901570 1.44% fatty acid derivative biosynthetic process
GO:0050886 1.44% endocrine process
GO:0043279 1.44% response to alkaloid
GO:0071276 1.44% cellular response to cadmium ion
GO:0019693 1.44% ribose phosphate metabolic process
GO:0035136 1.44% forelimb morphogenesis
GO:0060761 1.44% negative regulation of response to cytokine stimulus
GO:0032784 1.44% regulation of DNA-templated transcription, elongation
GO:0035188 1.44% hatching
GO:0048544 1.43% recognition of pollen
GO:0055008 1.43% cardiac muscle tissue morphogenesis
GO:0000278 1.43% mitotic cell cycle
GO:0080154 1.43% regulation of fertilization
GO:0090101 1.43% negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045687 1.43% positive regulation of glial cell differentiation
GO:0045793 1.43% positive regulation of cell size
GO:0009414 1.43% response to water deprivation
GO:0048259 1.42% regulation of receptor-mediated endocytosis
GO:0045088 1.42% regulation of innate immune response
GO:1903052 1.42% positive regulation of proteolysis involved in cellular protein catabolic process
GO:0051188 1.42% cofactor biosynthetic process
GO:0022618 1.42% ribonucleoprotein complex assembly
GO:0070085 1.42% glycosylation
GO:0045620 1.42% negative regulation of lymphocyte differentiation
GO:0030178 1.42% negative regulation of Wnt signaling pathway
GO:1901797 1.42% negative regulation of signal transduction by p53 class mediator
GO:0030890 1.42% positive regulation of B cell proliferation
GO:0043409 1.42% negative regulation of MAPK cascade
GO:0009753 1.42% response to jasmonic acid
GO:0051187 1.42% cofactor catabolic process
GO:0046622 1.42% positive regulation of organ growth
GO:2001222 1.41% regulation of neuron migration
GO:0051250 1.41% negative regulation of lymphocyte activation
GO:1904706 1.41% negative regulation of vascular smooth muscle cell proliferation
GO:0051223 1.41% regulation of protein transport
GO:0031647 1.41% regulation of protein stability
GO:0043500 1.41% muscle adaptation
GO:0031400 1.41% negative regulation of protein modification process
GO:0060359 1.41% response to ammonium ion
GO:0006379 1.41% mRNA cleavage
GO:0009642 1.41% response to light intensity
GO:0070665 1.41% positive regulation of leukocyte proliferation
GO:0050685 1.41% positive regulation of mRNA processing
GO:1903312 1.41% negative regulation of mRNA metabolic process
GO:0006914 1.40% autophagy
GO:0007229 1.40% integrin-mediated signaling pathway
GO:0042303 1.40% molting cycle
GO:0006650 1.40% glycerophospholipid metabolic process
GO:0010676 1.40% positive regulation of cellular carbohydrate metabolic process
GO:0046328 1.40% regulation of JNK cascade
GO:0014850 1.40% response to muscle activity
GO:0001961 1.40% positive regulation of cytokine-mediated signaling pathway
GO:1903320 1.40% regulation of protein modification by small protein conjugation or removal
GO:0048864 1.40% stem cell development
GO:0006111 1.40% regulation of gluconeogenesis
GO:0042572 1.40% retinol metabolic process
GO:0032786 1.39% positive regulation of DNA-templated transcription, elongation
GO:0099177 1.39% regulation of trans-synaptic signaling
GO:0045184 1.39% establishment of protein localization
GO:0043562 1.39% cellular response to nitrogen levels
GO:0034394 1.39% protein localization to cell surface
GO:0043255 1.39% regulation of carbohydrate biosynthetic process
GO:0005975 1.39% carbohydrate metabolic process
GO:2000249 1.39% regulation of actin cytoskeleton reorganization
GO:0031341 1.39% regulation of cell killing
GO:0010959 1.39% regulation of metal ion transport
GO:0010883 1.39% regulation of lipid storage
GO:1903409 1.38% reactive oxygen species biosynthetic process
GO:0072163 1.38% mesonephric epithelium development
GO:0045939 1.38% negative regulation of steroid metabolic process
GO:0006511 1.38% ubiquitin-dependent protein catabolic process
GO:0034391 1.38% regulation of smooth muscle cell apoptotic process
GO:0007187 1.38% G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0032069 1.38% regulation of nuclease activity
GO:0007619 1.38% courtship behavior
GO:0015031 1.38% protein transport
GO:1902893 1.38% regulation of pri-miRNA transcription by RNA polymerase II
GO:1901991 1.38% negative regulation of mitotic cell cycle phase transition
GO:0051276 1.38% chromosome organization
GO:0009988 1.37% cell-cell recognition
GO:0050684 1.37% regulation of mRNA processing
GO:1990266 1.37% neutrophil migration
GO:0006268 1.37% DNA unwinding involved in DNA replication
GO:0043473 1.37% pigmentation
GO:0032968 1.37% positive regulation of transcription elongation from RNA polymerase II promoter
GO:1900087 1.37% positive regulation of G1/S transition of mitotic cell cycle
GO:1905818 1.37% regulation of chromosome separation
GO:0030001 1.37% metal ion transport
GO:0022008 1.37% neurogenesis
GO:0006282 1.37% regulation of DNA repair
GO:0040020 1.37% regulation of meiotic nuclear division
GO:0048255 1.36% mRNA stabilization
GO:0090342 1.36% regulation of cell aging
GO:0051783 1.36% regulation of nuclear division
GO:0044070 1.36% regulation of anion transport
GO:0030168 1.36% platelet activation
GO:0061982 1.36% meiosis I cell cycle process
GO:0014911 1.36% positive regulation of smooth muscle cell migration
GO:0051654 1.36% establishment of mitochondrion localization
GO:0016053 1.36% organic acid biosynthetic process
GO:0006458 1.36% 'de novo' protein folding
GO:1902373 1.36% negative regulation of mRNA catabolic process
GO:0010623 1.35% programmed cell death involved in cell development
GO:0048477 1.35% oogenesis
GO:0045723 1.35% positive regulation of fatty acid biosynthetic process
GO:2000637 1.35% positive regulation of gene silencing by miRNA
GO:0010823 1.35% negative regulation of mitochondrion organization
GO:0002889 1.35% regulation of immunoglobulin mediated immune response
GO:0032365 1.35% intracellular lipid transport
GO:0009952 1.35% anterior/posterior pattern specification
GO:0010970 1.35% transport along microtubule
GO:0098630 1.34% aggregation of unicellular organisms
GO:0071103 1.34% DNA conformation change
GO:1901678 1.34% iron coordination entity transport
GO:0048261 1.34% negative regulation of receptor-mediated endocytosis
GO:0048581 1.34% negative regulation of post-embryonic development
GO:1904030 1.34% negative regulation of cyclin-dependent protein kinase activity
GO:0009953 1.34% dorsal/ventral pattern formation
GO:0002718 1.34% regulation of cytokine production involved in immune response
GO:0031343 1.34% positive regulation of cell killing
GO:0008585 1.34% female gonad development
GO:0045668 1.34% negative regulation of osteoblast differentiation
GO:0072678 1.33% T cell migration
GO:0048147 1.33% negative regulation of fibroblast proliferation
GO:0009880 1.33% embryonic pattern specification
GO:0001656 1.33% metanephros development
GO:0030513 1.33% positive regulation of BMP signaling pathway
GO:0048704 1.33% embryonic skeletal system morphogenesis
GO:0048709 1.33% oligodendrocyte differentiation
GO:1903008 1.33% organelle disassembly
GO:0090068 1.33% positive regulation of cell cycle process
GO:0009639 1.33% response to red or far red light
GO:0097366 1.33% response to bronchodilator
GO:0050792 1.32% regulation of viral process
GO:0031570 1.32% DNA integrity checkpoint
GO:0051348 1.32% negative regulation of transferase activity
GO:0002705 1.32% positive regulation of leukocyte mediated immunity
GO:0072595 1.32% maintenance of protein localization in organelle
GO:1903322 1.32% positive regulation of protein modification by small protein conjugation or removal
GO:0042157 1.32% lipoprotein metabolic process
GO:0140253 1.32% cell-cell fusion
GO:0034110 1.32% regulation of homotypic cell-cell adhesion
GO:0046474 1.32% glycerophospholipid biosynthetic process
GO:0001662 1.32% behavioral fear response
GO:0070228 1.32% regulation of lymphocyte apoptotic process
GO:1903305 1.32% regulation of regulated secretory pathway
GO:0002793 1.32% positive regulation of peptide secretion
GO:0000375 1.32% RNA splicing, via transesterification reactions
GO:0032869 1.32% cellular response to insulin stimulus
GO:0030100 1.32% regulation of endocytosis
GO:0006352 1.31% DNA-templated transcription, initiation
GO:0001944 1.31% vasculature development
GO:0090218 1.31% positive regulation of lipid kinase activity
GO:0071869 1.31% response to catecholamine
GO:0032148 1.31% activation of protein kinase B activity
GO:1902808 1.31% positive regulation of cell cycle G1/S phase transition
GO:0061014 1.31% positive regulation of mRNA catabolic process
GO:0006940 1.31% regulation of smooth muscle contraction
GO:0010894 1.30% negative regulation of steroid biosynthetic process
GO:0050766 1.30% positive regulation of phagocytosis
GO:0006995 1.30% cellular response to nitrogen starvation
GO:0043552 1.30% positive regulation of phosphatidylinositol 3-kinase activity
GO:0047497 1.30% mitochondrion transport along microtubule
GO:0045830 1.30% positive regulation of isotype switching
GO:0009733 1.30% response to auxin
GO:0045746 1.30% negative regulation of Notch signaling pathway
GO:0045191 1.30% regulation of isotype switching
GO:0002888 1.30% positive regulation of myeloid leukocyte mediated immunity
GO:0060828 1.29% regulation of canonical Wnt signaling pathway
GO:0010803 1.29% regulation of tumor necrosis factor-mediated signaling pathway
GO:0060706 1.29% cell differentiation involved in embryonic placenta development
GO:1905939 1.29% regulation of gonad development
GO:0046394 1.29% carboxylic acid biosynthetic process
GO:1902991 1.29% regulation of amyloid precursor protein catabolic process
GO:0006022 1.29% aminoglycan metabolic process
GO:0071622 1.29% regulation of granulocyte chemotaxis
GO:0000737 1.29% DNA catabolic process, endonucleolytic
GO:0045686 1.29% negative regulation of glial cell differentiation
GO:0062033 1.29% positive regulation of mitotic sister chromatid segregation
GO:0031505 1.28% fungal-type cell wall organization
GO:0051924 1.28% regulation of calcium ion transport
GO:0090598 1.28% male anatomical structure morphogenesis
GO:0051084 1.28% 'de novo' posttranslational protein folding
GO:2001252 1.28% positive regulation of chromosome organization
GO:0000725 1.28% recombinational repair
GO:0048771 1.28% tissue remodeling
GO:0032008 1.28% positive regulation of TOR signaling
GO:0070059 1.28% intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0043547 1.28% positive regulation of GTPase activity
GO:0046456 1.28% icosanoid biosynthetic process
GO:0019226 1.28% transmission of nerve impulse
GO:1903532 1.28% positive regulation of secretion by cell
GO:0048663 1.28% neuron fate commitment
GO:0002429 1.27% immune response-activating cell surface receptor signaling pathway
GO:0010575 1.27% positive regulation of vascular endothelial growth factor production
GO:0014075 1.27% response to amine
GO:0045429 1.27% positive regulation of nitric oxide biosynthetic process
GO:0060191 1.27% regulation of lipase activity
GO:0033280 1.27% response to vitamin D
GO:0010259 1.27% multicellular organism aging
GO:0060429 1.27% epithelium development
GO:1901623 1.27% regulation of lymphocyte chemotaxis
GO:1903307 1.27% positive regulation of regulated secretory pathway
GO:0031152 1.27% aggregation involved in sorocarp development
GO:0072594 1.27% establishment of protein localization to organelle
GO:0061061 1.27% muscle structure development
GO:0031396 1.27% regulation of protein ubiquitination
GO:0021675 1.27% nerve development
GO:0035148 1.27% tube formation
GO:1904036 1.27% negative regulation of epithelial cell apoptotic process
GO:1902895 1.27% positive regulation of pri-miRNA transcription by RNA polymerase II
GO:0033005 1.27% positive regulation of mast cell activation
GO:0016114 1.27% terpenoid biosynthetic process
GO:0001935 1.26% endothelial cell proliferation
GO:0006968 1.26% cellular defense response
GO:0023014 1.26% signal transduction by protein phosphorylation
GO:0042659 1.26% regulation of cell fate specification
GO:0046887 1.26% positive regulation of hormone secretion
GO:0000075 1.26% cell cycle checkpoint
GO:0046632 1.26% alpha-beta T cell differentiation
GO:0060999 1.26% positive regulation of dendritic spine development
GO:0000077 1.26% DNA damage checkpoint
GO:0033673 1.26% negative regulation of kinase activity
GO:0071692 1.26% protein localization to extracellular region
GO:0098586 1.26% cellular response to virus
GO:0071555 1.26% cell wall organization
GO:0071554 1.26% cell wall organization or biogenesis
GO:0010667 1.25% negative regulation of cardiac muscle cell apoptotic process
GO:0014032 1.25% neural crest cell development
GO:0006836 1.25% neurotransmitter transport
GO:0045621 1.25% positive regulation of lymphocyte differentiation
GO:0019430 1.25% removal of superoxide radicals
GO:0032928 1.25% regulation of superoxide anion generation
GO:1904029 1.25% regulation of cyclin-dependent protein kinase activity
GO:0007188 1.25% adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0009637 1.25% response to blue light
GO:0043010 1.25% camera-type eye development
GO:0032720 1.25% negative regulation of tumor necrosis factor production
GO:0001835 1.25% blastocyst hatching
GO:0006040 1.25% amino sugar metabolic process
GO:0009190 1.25% cyclic nucleotide biosynthetic process
GO:0051155 1.25% positive regulation of striated muscle cell differentiation
GO:0034114 1.25% regulation of heterotypic cell-cell adhesion
GO:0010332 1.25% response to gamma radiation
GO:0061448 1.25% connective tissue development
GO:1901568 1.25% fatty acid derivative metabolic process
GO:0071826 1.25% ribonucleoprotein complex subunit organization
GO:0050764 1.25% regulation of phagocytosis
GO:0045671 1.24% negative regulation of osteoclast differentiation
GO:1904707 1.24% positive regulation of vascular smooth muscle cell proliferation
GO:0018904 1.24% ether metabolic process
GO:0015914 1.24% phospholipid transport
GO:0010288 1.24% response to lead ion
GO:0051493 1.24% regulation of cytoskeleton organization
GO:0006547 1.24% histidine metabolic process
GO:0034587 1.24% piRNA metabolic process
GO:1903556 1.24% negative regulation of tumor necrosis factor superfamily cytokine production
GO:0099402 1.24% plant organ development
GO:0055094 1.24% response to lipoprotein particle
GO:0035112 1.24% genitalia morphogenesis
GO:0000724 1.24% double-strand break repair via homologous recombination
GO:1903793 1.23% positive regulation of anion transport
GO:0016125 1.23% sterol metabolic process
GO:2000401 1.23% regulation of lymphocyte migration
GO:0031288 1.23% sorocarp morphogenesis
GO:0008203 1.23% cholesterol metabolic process
GO:0060147 1.23% regulation of posttranscriptional gene silencing
GO:0033209 1.23% tumor necrosis factor-mediated signaling pathway
GO:0019985 1.23% translesion synthesis
GO:0033688 1.23% regulation of osteoblast proliferation
GO:1900140 1.23% regulation of seedling development
GO:0055076 1.23% transition metal ion homeostasis
GO:0051769 1.23% regulation of nitric-oxide synthase biosynthetic process
GO:0050804 1.22% modulation of chemical synaptic transmission
GO:0035592 1.22% establishment of protein localization to extracellular region
GO:0048592 1.22% eye morphogenesis
GO:0000377 1.22% RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0048026 1.22% positive regulation of mRNA splicing, via spliceosome
GO:0060612 1.22% adipose tissue development
GO:0006942 1.22% regulation of striated muscle contraction
GO:0060964 1.22% regulation of gene silencing by miRNA
GO:0010633 1.22% negative regulation of epithelial cell migration
GO:0014888 1.22% striated muscle adaptation
GO:0044282 1.22% small molecule catabolic process
GO:0033365 1.22% protein localization to organelle
GO:0051339 1.22% regulation of lyase activity
GO:0030501 1.22% positive regulation of bone mineralization
GO:0009948 1.22% anterior/posterior axis specification
GO:0019369 1.22% arachidonic acid metabolic process
GO:2000059 1.22% negative regulation of ubiquitin-dependent protein catabolic process
GO:0034762 1.22% regulation of transmembrane transport
GO:0031145 1.21% anaphase-promoting complex-dependent catabolic process
GO:0044344 1.21% cellular response to fibroblast growth factor stimulus
GO:0052652 1.21% cyclic purine nucleotide metabolic process
GO:1900101 1.21% regulation of endoplasmic reticulum unfolded protein response
GO:0043433 1.21% negative regulation of DNA-binding transcription factor activity
GO:1901617 1.21% organic hydroxy compound biosynthetic process
GO:0051495 1.21% positive regulation of cytoskeleton organization
GO:0070168 1.21% negative regulation of biomineral tissue development
GO:1900151 1.21% regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0042743 1.21% hydrogen peroxide metabolic process
GO:0035115 1.20% embryonic forelimb morphogenesis
GO:0015908 1.20% fatty acid transport
GO:0000018 1.20% regulation of DNA recombination
GO:2000736 1.20% regulation of stem cell differentiation
GO:0014059 1.20% regulation of dopamine secretion
GO:0034643 1.20% establishment of mitochondrion localization, microtubule-mediated
GO:0006826 1.20% iron ion transport
GO:0015849 1.20% organic acid transport
GO:0010907 1.20% positive regulation of glucose metabolic process
GO:0009306 1.20% protein secretion
GO:0044770 1.20% cell cycle phase transition
GO:0070873 1.20% regulation of glycogen metabolic process
GO:0034243 1.20% regulation of transcription elongation from RNA polymerase II promoter
GO:0071867 1.20% response to monoamine
GO:0002090 1.20% regulation of receptor internalization
GO:0060998 1.20% regulation of dendritic spine development
GO:0071468 1.19% cellular response to acidic pH
GO:0014014 1.19% negative regulation of gliogenesis
GO:0120178 1.19% steroid hormone biosynthetic process
GO:0007585 1.19% respiratory gaseous exchange by respiratory system
GO:2000108 1.19% positive regulation of leukocyte apoptotic process
GO:0048514 1.19% blood vessel morphogenesis
GO:0010226 1.19% response to lithium ion
GO:0051251 1.19% positive regulation of lymphocyte activation
GO:0009260 1.19% ribonucleotide biosynthetic process
GO:0055074 1.19% calcium ion homeostasis
GO:0110150 1.19% negative regulation of biomineralization
GO:0034105 1.19% positive regulation of tissue remodeling
GO:0051651 1.19% maintenance of location in cell
GO:0007127 1.19% meiosis I
GO:0060966 1.19% regulation of gene silencing by RNA
GO:0033045 1.19% regulation of sister chromatid segregation
GO:0010389 1.19% regulation of G2/M transition of mitotic cell cycle
GO:0000731 1.18% DNA synthesis involved in DNA repair
GO:0051341 1.18% regulation of oxidoreductase activity
GO:2000403 1.18% positive regulation of lymphocyte migration
GO:0031398 1.18% positive regulation of protein ubiquitination
GO:0070920 1.18% regulation of production of small RNA involved in gene silencing by RNA
GO:0000165 1.18% MAPK cascade
GO:0061515 1.18% myeloid cell development
GO:0070206 1.18% protein trimerization
GO:0010812 1.18% negative regulation of cell-substrate adhesion
GO:0021766 1.18% hippocampus development
GO:0070304 1.18% positive regulation of stress-activated protein kinase signaling cascade
GO:0030947 1.18% regulation of vascular endothelial growth factor receptor signaling pathway
GO:0009909 1.18% regulation of flower development
GO:0071684 1.18% organism emergence from protective structure
GO:1903363 1.18% negative regulation of cellular protein catabolic process
GO:0033619 1.17% membrane protein proteolysis
GO:0006641 1.17% triglyceride metabolic process
GO:0032892 1.17% positive regulation of organic acid transport
GO:0050927 1.17% positive regulation of positive chemotaxis
GO:0010965 1.17% regulation of mitotic sister chromatid separation
GO:0043300 1.17% regulation of leukocyte degranulation
GO:0045229 1.17% external encapsulating structure organization
GO:1902235 1.17% regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:0032330 1.17% regulation of chondrocyte differentiation
GO:0048024 1.17% regulation of mRNA splicing, via spliceosome
GO:1903432 1.17% regulation of TORC1 signaling
GO:0006958 1.17% complement activation, classical pathway
GO:0046628 1.17% positive regulation of insulin receptor signaling pathway
GO:0071480 1.17% cellular response to gamma radiation
GO:0006636 1.17% unsaturated fatty acid biosynthetic process
GO:2000060 1.17% positive regulation of ubiquitin-dependent protein catabolic process
GO:0071470 1.17% cellular response to osmotic stress
GO:0002768 1.17% immune response-regulating cell surface receptor signaling pathway
GO:0006302 1.17% double-strand break repair
GO:0032874 1.16% positive regulation of stress-activated MAPK cascade
GO:1901522 1.16% positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus
GO:0061726 1.16% mitochondrion disassembly
GO:0042634 1.16% regulation of hair cycle
GO:0032944 1.16% regulation of mononuclear cell proliferation
GO:1903900 1.16% regulation of viral life cycle
GO:0014912 1.16% negative regulation of smooth muscle cell migration
GO:0006941 1.16% striated muscle contraction
GO:0090288 1.16% negative regulation of cellular response to growth factor stimulus
GO:0003044 1.16% regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0009855 1.16% determination of bilateral symmetry
GO:1902749 1.16% regulation of cell cycle G2/M phase transition
GO:0051973 1.16% positive regulation of telomerase activity
GO:0019935 1.16% cyclic-nucleotide-mediated signaling
GO:0008360 1.16% regulation of cell shape
GO:0048569 1.15% post-embryonic animal organ development
GO:0051983 1.15% regulation of chromosome segregation
GO:0048168 1.15% regulation of neuronal synaptic plasticity
GO:0051146 1.15% striated muscle cell differentiation
GO:0045773 1.15% positive regulation of axon extension
GO:0045931 1.15% positive regulation of mitotic cell cycle
GO:0046942 1.15% carboxylic acid transport
GO:0060485 1.15% mesenchyme development
GO:0060348 1.15% bone development
GO:0006026 1.15% aminoglycan catabolic process
GO:0090407 1.15% organophosphate biosynthetic process
GO:0042753 1.15% positive regulation of circadian rhythm
GO:0050708 1.15% regulation of protein secretion
GO:1903827 1.15% regulation of cellular protein localization
GO:0002209 1.15% behavioral defense response
GO:0010029 1.15% regulation of seed germination
GO:0043330 1.14% response to exogenous dsRNA
GO:0032392 1.14% DNA geometric change
GO:0006521 1.14% regulation of cellular amino acid metabolic process
GO:2001032 1.14% regulation of double-strand break repair via nonhomologous end joining
GO:0045806 1.14% negative regulation of endocytosis
GO:0071621 1.14% granulocyte chemotaxis
GO:0002040 1.14% sprouting angiogenesis
GO:0016241 1.14% regulation of macroautophagy
GO:0002701 1.14% negative regulation of production of molecular mediator of immune response
GO:0006359 1.14% regulation of transcription by RNA polymerase III
GO:1904951 1.13% positive regulation of establishment of protein localization
GO:0042762 1.13% regulation of sulfur metabolic process
GO:1903522 1.13% regulation of blood circulation
GO:0000079 1.13% regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0032352 1.13% positive regulation of hormone metabolic process
GO:0008016 1.13% regulation of heart contraction
GO:0006364 1.13% rRNA processing
GO:0061005 1.13% cell differentiation involved in kidney development
GO:0006298 1.13% mismatch repair
GO:0048286 1.13% lung alveolus development
GO:0007368 1.13% determination of left/right symmetry
GO:0014048 1.13% regulation of glutamate secretion
GO:0001782 1.13% B cell homeostasis
GO:0021953 1.13% central nervous system neuron differentiation
GO:0000105 1.13% histidine biosynthetic process
GO:0048806 1.13% genitalia development
GO:0007517 1.12% muscle organ development
GO:0006887 1.12% exocytosis
GO:0007339 1.12% binding of sperm to zona pellucida
GO:0001569 1.12% branching involved in blood vessel morphogenesis
GO:0044403 1.12% symbiotic process
GO:1901798 1.12% positive regulation of signal transduction by p53 class mediator
GO:0034470 1.12% ncRNA processing
GO:0043632 1.12% modification-dependent macromolecule catabolic process
GO:0090150 1.12% establishment of protein localization to membrane
GO:0043270 1.12% positive regulation of ion transport
GO:0010656 1.12% negative regulation of muscle cell apoptotic process
GO:0051353 1.12% positive regulation of oxidoreductase activity
GO:0016311 1.12% dephosphorylation
GO:0033143 1.12% regulation of intracellular steroid hormone receptor signaling pathway
GO:0006910 1.12% phagocytosis, recognition
GO:0019941 1.12% modification-dependent protein catabolic process
GO:0050868 1.12% negative regulation of T cell activation
GO:0045124 1.12% regulation of bone resorption
GO:0031648 1.12% protein destabilization
GO:0007520 1.11% myoblast fusion
GO:0048713 1.11% regulation of oligodendrocyte differentiation
GO:0000578 1.11% embryonic axis specification
GO:0006366 1.11% transcription by RNA polymerase II
GO:1901739 1.11% regulation of myoblast fusion
GO:0045739 1.11% positive regulation of DNA repair
GO:0042168 1.11% heme metabolic process
GO:0031069 1.11% hair follicle morphogenesis
GO:0008088 1.11% axo-dendritic transport
GO:1902019 1.11% regulation of cilium-dependent cell motility
GO:0046631 1.11% alpha-beta T cell activation
GO:0002720 1.11% positive regulation of cytokine production involved in immune response
GO:0015844 1.11% monoamine transport
GO:0033077 1.11% T cell differentiation in thymus
GO:0070229 1.11% negative regulation of lymphocyte apoptotic process
GO:0044242 1.11% cellular lipid catabolic process
GO:1903901 1.11% negative regulation of viral life cycle
GO:0007588 1.11% excretion
GO:0006778 1.11% porphyrin-containing compound metabolic process
GO:0070507 1.10% regulation of microtubule cytoskeleton organization
GO:0071398 1.10% cellular response to fatty acid
GO:0034293 1.10% sexual sporulation
GO:0031056 1.10% regulation of histone modification
GO:0002764 1.10% immune response-regulating signaling pathway
GO:0090207 1.10% regulation of triglyceride metabolic process
GO:0097755 1.10% positive regulation of blood vessel diameter
GO:0046888 1.10% negative regulation of hormone secretion
GO:0022404 1.10% molting cycle process
GO:0071852 1.10% fungal-type cell wall organization or biogenesis
GO:0010884 1.10% positive regulation of lipid storage
GO:0060456 1.10% positive regulation of digestive system process
GO:1901983 1.09% regulation of protein acetylation
GO:0000422 1.09% autophagy of mitochondrion
GO:1903524 1.09% positive regulation of blood circulation
GO:0110053 1.09% regulation of actin filament organization
GO:0016055 1.09% Wnt signaling pathway
GO:0010447 1.09% response to acidic pH
GO:0008277 1.09% regulation of G protein-coupled receptor signaling pathway
GO:0043388 1.09% positive regulation of DNA binding
GO:0014896 1.09% muscle hypertrophy
GO:0001657 1.09% ureteric bud development
GO:1902903 1.09% regulation of supramolecular fiber organization
GO:0007007 1.09% inner mitochondrial membrane organization
GO:0014743 1.09% regulation of muscle hypertrophy
GO:0035036 1.09% sperm-egg recognition
GO:0043484 1.09% regulation of RNA splicing
GO:0001837 1.09% epithelial to mesenchymal transition
GO:0015979 1.09% photosynthesis
GO:0007159 1.08% leukocyte cell-cell adhesion
GO:1903829 1.08% positive regulation of cellular protein localization
GO:0006664 1.08% glycolipid metabolic process
GO:0010596 1.08% negative regulation of endothelial cell migration
GO:0032692 1.08% negative regulation of interleukin-1 production
GO:0000226 1.08% microtubule cytoskeleton organization
GO:0032890 1.08% regulation of organic acid transport
GO:0046850 1.08% regulation of bone remodeling
GO:0032691 1.08% negative regulation of interleukin-1 beta production
GO:0022409 1.08% positive regulation of cell-cell adhesion
GO:0006446 1.08% regulation of translational initiation
GO:0072175 1.08% epithelial tube formation
GO:0046685 1.07% response to arsenic-containing substance
GO:0030031 1.07% cell projection assembly
GO:0006119 1.07% oxidative phosphorylation
GO:1902275 1.07% regulation of chromatin organization
GO:0009624 1.07% response to nematode
GO:0042254 1.07% ribosome biogenesis
GO:0046337 1.07% phosphatidylethanolamine metabolic process
GO:2000756 1.07% regulation of peptidyl-lysine acetylation
GO:0044319 1.07% wound healing, spreading of cells
GO:0001953 1.07% negative regulation of cell-matrix adhesion
GO:0009595 1.07% detection of biotic stimulus
GO:0035264 1.07% multicellular organism growth
GO:0070849 1.07% response to epidermal growth factor
GO:0046825 1.07% regulation of protein export from nucleus
GO:0000398 1.06% mRNA splicing, via spliceosome
GO:0035813 1.06% regulation of renal sodium excretion
GO:0031098 1.06% stress-activated protein kinase signaling cascade
GO:0045933 1.06% positive regulation of muscle contraction
GO:0032508 1.06% DNA duplex unwinding
GO:0098581 1.06% detection of external biotic stimulus
GO:0016054 1.06% organic acid catabolic process
GO:0006690 1.06% icosanoid metabolic process
GO:0048010 1.06% vascular endothelial growth factor receptor signaling pathway
GO:0045823 1.06% positive regulation of heart contraction
GO:0045069 1.06% regulation of viral genome replication
GO:0043407 1.06% negative regulation of MAP kinase activity
GO:1903747 1.06% regulation of establishment of protein localization to mitochondrion
GO:0009630 1.06% gravitropism
GO:1905475 1.06% regulation of protein localization to membrane
GO:0030593 1.06% neutrophil chemotaxis
GO:0010518 1.06% positive regulation of phospholipase activity
GO:0042311 1.05% vasodilation
GO:0070252 1.05% actin-mediated cell contraction
GO:0099111 1.05% microtubule-based transport
GO:0006656 1.05% phosphatidylcholine biosynthetic process
GO:0001556 1.05% oocyte maturation
GO:0007492 1.05% endoderm development
GO:0098926 1.05% postsynaptic signal transduction
GO:0000280 1.05% nuclear division
GO:0007163 1.05% establishment or maintenance of cell polarity
GO:2001057 1.05% reactive nitrogen species metabolic process
GO:0009112 1.05% nucleobase metabolic process
GO:0010800 1.05% positive regulation of peptidyl-threonine phosphorylation
GO:0098657 1.05% import into cell
GO:0007297 1.04% ovarian follicle cell migration
GO:0060281 1.04% regulation of oocyte development
GO:0060968 1.04% regulation of gene silencing
GO:0045921 1.04% positive regulation of exocytosis
GO:0045055 1.04% regulated exocytosis
GO:0045980 1.04% negative regulation of nucleotide metabolic process
GO:1903509 1.04% liposaccharide metabolic process
GO:0060688 1.04% regulation of morphogenesis of a branching structure
GO:0048013 1.04% ephrin receptor signaling pathway
GO:1900006 1.04% positive regulation of dendrite development
GO:0090596 1.04% sensory organ morphogenesis
GO:1902884 1.04% positive regulation of response to oxidative stress
GO:0032663 1.04% regulation of interleukin-2 production
GO:0030316 1.04% osteoclast differentiation
GO:0010828 1.04% positive regulation of glucose transmembrane transport
GO:0090049 1.04% regulation of cell migration involved in sprouting angiogenesis
GO:0042773 1.03% ATP synthesis coupled electron transport
GO:0017001 1.03% antibiotic catabolic process
GO:0051457 1.03% maintenance of protein location in nucleus
GO:0046395 1.03% carboxylic acid catabolic process
GO:0009152 1.03% purine ribonucleotide biosynthetic process
GO:0007088 1.03% regulation of mitotic nuclear division
GO:0046688 1.03% response to copper ion
GO:0050670 1.03% regulation of lymphocyte proliferation
GO:0002244 1.03% hematopoietic progenitor cell differentiation
GO:1903037 1.03% regulation of leukocyte cell-cell adhesion
GO:0006692 1.03% prostanoid metabolic process
GO:0002757 1.03% immune response-activating signal transduction
GO:0001659 1.03% temperature homeostasis
GO:0006305 1.03% DNA alkylation
GO:0010574 1.03% regulation of vascular endothelial growth factor production
GO:0098930 1.03% axonal transport
GO:0090502 1.03% RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0034695 1.02% response to prostaglandin E
GO:0006325 1.02% chromatin organization
GO:0048701 1.02% embryonic cranial skeleton morphogenesis
GO:1903051 1.02% negative regulation of proteolysis involved in cellular protein catabolic process
GO:0007265 1.02% Ras protein signal transduction
GO:0030203 1.02% glycosaminoglycan metabolic process
GO:0002181 1.02% cytoplasmic translation
GO:0048871 1.02% multicellular organismal homeostasis
GO:1900426 1.02% positive regulation of defense response to bacterium
GO:0045727 1.02% positive regulation of translation
GO:0010718 1.02% positive regulation of epithelial to mesenchymal transition
GO:0050851 1.02% antigen receptor-mediated signaling pathway
GO:0072507 1.02% divalent inorganic cation homeostasis
GO:0006338 1.02% chromatin remodeling
GO:0050770 1.02% regulation of axonogenesis
GO:0010517 1.02% regulation of phospholipase activity
GO:0006875 1.02% cellular metal ion homeostasis
GO:0045672 1.01% positive regulation of osteoclast differentiation
GO:0033047 1.01% regulation of mitotic sister chromatid segregation
GO:0008654 1.01% phospholipid biosynthetic process
GO:0002706 1.01% regulation of lymphocyte mediated immunity
GO:0032354 1.01% response to follicle-stimulating hormone
GO:0000959 1.01% mitochondrial RNA metabolic process
GO:1904666 1.01% regulation of ubiquitin protein ligase activity
GO:2000772 1.01% regulation of cellular senescence
GO:0001990 1.01% regulation of systemic arterial blood pressure by hormone
GO:1901970 1.01% positive regulation of mitotic sister chromatid separation
GO:0010863 1.01% positive regulation of phospholipase C activity
GO:1903038 1.01% negative regulation of leukocyte cell-cell adhesion
GO:0050926 1.01% regulation of positive chemotaxis
GO:0019318 1.01% hexose metabolic process
GO:0009799 1.01% specification of symmetry
GO:0031047 1.01% gene silencing by RNA
GO:0060143 1.01% positive regulation of syncytium formation by plasma membrane fusion
GO:0043302 1.01% positive regulation of leukocyte degranulation
GO:2000142 1.01% regulation of DNA-templated transcription, initiation
GO:0006122 1.01% mitochondrial electron transport, ubiquinol to cytochrome c
GO:0042447 1.00% hormone catabolic process
GO:0046390 1.00% ribose phosphate biosynthetic process
GO:0032259 1.00% methylation
GO:0001975 1.00% response to amphetamine
GO:0046189 1.00% phenol-containing compound biosynthetic process
GO:0022613 1.00% ribonucleoprotein complex biogenesis
GO:0006027 1.00% glycosaminoglycan catabolic process
GO:0000712 1.00% resolution of meiotic recombination intermediates
GO:1902993 1.00% positive regulation of amyloid precursor protein catabolic process
GO:0002822 1.00% regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
Back
Download
TOP