TOP
UniProt ID:
P02882
Entry Name:
MONB_DIOCU
Sequence:
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN
Molecular Function
Biological Process
Cellular Component
Score (%) 8.62~19.50
GO Terms Score Description
GO:0008150 19.50% biological_process
GO:0065007 16.95% biological regulation
GO:0050789 16.31% regulation of biological process
GO:0050794 15.49% regulation of cellular process
GO:0009987 14.28% cellular process
GO:0007165 11.60% signal transduction
GO:0032501 11.35% multicellular organismal process
GO:0032502 11.11% developmental process
GO:0019222 10.45% regulation of metabolic process
GO:0050896 10.24% response to stimulus
GO:0065008 9.99% regulation of biological quality
GO:0010646 9.50% regulation of cell communication
GO:0051239 9.45% regulation of multicellular organismal process
GO:0023051 9.45% regulation of signaling
GO:0031323 9.36% regulation of cellular metabolic process
GO:0080090 9.32% regulation of primary metabolic process
GO:0048519 9.28% negative regulation of biological process
GO:0048856 9.28% anatomical structure development
GO:0060255 9.18% regulation of macromolecule metabolic process
GO:0048583 9.15% regulation of response to stimulus
GO:0051179 8.97% localization
GO:0071704 8.77% organic substance metabolic process
GO:0051234 8.70% establishment of localization
GO:0008152 8.67% metabolic process
GO:0048523 8.62% negative regulation of cellular process
GO:0044238 8.56% primary metabolic process
GO:0006810 8.51% transport
GO:0051171 8.51% regulation of nitrogen compound metabolic process
GO:0009966 8.44% regulation of signal transduction
GO:0048518 8.44% positive regulation of biological process
GO:0048869 8.43% cellular developmental process
GO:0050793 8.29% regulation of developmental process
GO:0009628 8.04% response to abiotic stimulus
GO:0042221 8.02% response to chemical
GO:0003008 7.97% system process
GO:0051704 7.94% multi-organism process
GO:0035556 7.85% intracellular signal transduction
GO:0044237 7.81% cellular metabolic process
GO:0006950 7.78% response to stress
GO:0009653 7.59% anatomical structure morphogenesis
GO:0007186 7.53% G protein-coupled receptor signaling pathway
GO:0048522 7.51% positive regulation of cellular process
GO:0050790 7.42% regulation of catalytic activity
GO:0010468 7.41% regulation of gene expression
GO:0009889 7.38% regulation of biosynthetic process
GO:0006793 7.38% phosphorus metabolic process
GO:0009605 7.34% response to external stimulus
GO:0030154 7.31% cell differentiation
GO:0065009 7.28% regulation of molecular function
GO:0006796 7.24% phosphate-containing compound metabolic process
GO:2000026 7.16% regulation of multicellular organismal development
GO:0044281 7.16% small molecule metabolic process
GO:0050877 7.14% nervous system process
GO:0022414 7.10% reproductive process
GO:0007610 7.09% behavior
GO:0031326 7.03% regulation of cellular biosynthetic process
GO:0006807 6.88% nitrogen compound metabolic process
GO:0042592 6.87% homeostatic process
GO:0051716 6.84% cellular response to stimulus
GO:0051246 6.80% regulation of protein metabolic process
GO:0009416 6.79% response to light stimulus
GO:0032268 6.66% regulation of cellular protein metabolic process
GO:0009314 6.59% response to radiation
GO:0009892 6.58% negative regulation of metabolic process
GO:0009607 6.57% response to biotic stimulus
GO:0043207 6.52% response to external biotic stimulus
GO:1901700 6.50% response to oxygen-containing compound
GO:0009719 6.49% response to endogenous stimulus
GO:0007275 6.47% multicellular organism development
GO:0006629 6.45% lipid metabolic process
GO:0032879 6.44% regulation of localization
GO:0005975 6.43% carbohydrate metabolic process
GO:0006952 6.42% defense response
GO:2000112 6.40% regulation of cellular macromolecule biosynthetic process
GO:0003006 6.39% developmental process involved in reproduction
GO:0048584 6.37% positive regulation of response to stimulus
GO:0010556 6.37% regulation of macromolecule biosynthetic process
GO:0023057 6.30% negative regulation of signaling
GO:0010648 6.29% negative regulation of cell communication
GO:0010033 6.29% response to organic substance
GO:0002376 6.28% immune system process
GO:0045595 6.28% regulation of cell differentiation
GO:0019219 6.27% regulation of nucleobase-containing compound metabolic process
GO:0043170 6.27% macromolecule metabolic process
GO:0071702 6.26% organic substance transport
GO:0048731 6.20% system development
GO:0071840 6.20% cellular component organization or biogenesis
GO:0016043 6.17% cellular component organization
GO:0051128 6.13% regulation of cellular component organization
GO:0006955 6.12% immune response
GO:0051707 6.11% response to other organism
GO:0048585 6.10% negative regulation of response to stimulus
GO:0009893 6.10% positive regulation of metabolic process
GO:0007600 6.10% sensory perception
GO:1901564 6.10% organonitrogen compound metabolic process
GO:0043900 6.09% regulation of multi-organism process
GO:0010035 6.08% response to inorganic substance
GO:1902531 6.06% regulation of intracellular signal transduction
GO:0007267 6.03% cell-cell signaling
GO:0070887 5.98% cellular response to chemical stimulus
GO:0009790 5.98% embryo development
GO:0048513 5.97% animal organ development
GO:0031324 5.95% negative regulation of cellular metabolic process
GO:0009725 5.94% response to hormone
GO:0023056 5.91% positive regulation of signaling
GO:0051174 5.91% regulation of phosphorus metabolic process
GO:0019220 5.90% regulation of phosphate metabolic process
GO:0010647 5.89% positive regulation of cell communication
GO:2001141 5.87% regulation of RNA biosynthetic process
GO:0051240 5.86% positive regulation of multicellular organismal process
GO:1903506 5.85% regulation of nucleic acid-templated transcription
GO:0006355 5.82% regulation of transcription, DNA-templated
GO:0007154 5.79% cell communication
GO:0010941 5.78% regulation of cell death
GO:0042127 5.78% regulation of cell population proliferation
GO:0009968 5.77% negative regulation of signal transduction
GO:0010817 5.77% regulation of hormone levels
GO:2000241 5.76% regulation of reproductive process
GO:0051252 5.74% regulation of RNA metabolic process
GO:0007166 5.73% cell surface receptor signaling pathway
GO:0023052 5.72% signaling
GO:0048878 5.72% chemical homeostasis
GO:0006928 5.70% movement of cell or subcellular component
GO:0048609 5.70% multicellular organismal reproductive process
GO:0040008 5.67% regulation of growth
GO:0019932 5.65% second-messenger-mediated signaling
GO:0048646 5.65% anatomical structure formation involved in morphogenesis
GO:0080134 5.58% regulation of response to stress
GO:0062012 5.54% regulation of small molecule metabolic process
GO:0010605 5.53% negative regulation of macromolecule metabolic process
GO:0022610 5.48% biological adhesion
GO:0043067 5.47% regulation of programmed cell death
GO:0043085 5.46% positive regulation of catalytic activity
GO:0033554 5.45% cellular response to stress
GO:0031399 5.43% regulation of protein modification process
GO:0032989 5.42% cellular component morphogenesis
GO:0033993 5.42% response to lipid
GO:0007155 5.42% cell adhesion
GO:0043086 5.41% negative regulation of catalytic activity
GO:0051172 5.38% negative regulation of nitrogen compound metabolic process
GO:0040011 5.38% locomotion
GO:0044057 5.36% regulation of system process
GO:0014070 5.33% response to organic cyclic compound
GO:0009967 5.32% positive regulation of signal transduction
GO:0009755 5.31% hormone-mediated signaling pathway
GO:0016310 5.29% phosphorylation
GO:0051336 5.29% regulation of hydrolase activity
GO:0051049 5.27% regulation of transport
GO:0006970 5.25% response to osmotic stress
GO:0019538 5.24% protein metabolic process
GO:1901360 5.20% organic cyclic compound metabolic process
GO:0051094 5.17% positive regulation of developmental process
GO:0042981 5.16% regulation of apoptotic process
GO:0040012 5.16% regulation of locomotion
GO:0046890 5.15% regulation of lipid biosynthetic process
GO:0032269 5.14% negative regulation of cellular protein metabolic process
GO:0042325 5.13% regulation of phosphorylation
GO:0007167 5.12% enzyme linked receptor protein signaling pathway
GO:0051241 5.12% negative regulation of multicellular organismal process
GO:0044093 5.12% positive regulation of molecular function
GO:0051248 5.10% negative regulation of protein metabolic process
GO:0009791 5.09% post-embryonic development
GO:0044260 5.05% cellular macromolecule metabolic process
GO:0104004 5.04% cellular response to environmental stimulus
GO:0009792 5.04% embryo development ending in birth or egg hatching
GO:0071214 5.03% cellular response to abiotic stimulus
GO:0040007 5.01% growth
GO:2000145 5.01% regulation of cell motility
GO:0048589 5.00% developmental growth
GO:0098542 4.96% defense response to other organism
GO:0044092 4.96% negative regulation of molecular function
GO:0019725 4.94% cellular homeostasis
GO:0032101 4.94% regulation of response to external stimulus
GO:0044255 4.93% cellular lipid metabolic process
GO:0006811 4.93% ion transport
GO:0098771 4.93% inorganic ion homeostasis
GO:0006109 4.92% regulation of carbohydrate metabolic process
GO:0001539 4.91% cilium or flagellum-dependent cell motility
GO:0008284 4.90% positive regulation of cell population proliferation
GO:0051270 4.89% regulation of cellular component movement
GO:0048608 4.89% reproductive structure development
GO:0043902 4.88% positive regulation of multi-organism process
GO:0097305 4.88% response to alcohol
GO:0009617 4.87% response to bacterium
GO:0044087 4.86% regulation of cellular component biogenesis
GO:0042493 4.84% response to drug
GO:0097722 4.84% sperm motility
GO:0051338 4.83% regulation of transferase activity
GO:0010038 4.82% response to metal ion
GO:0009888 4.82% tissue development
GO:0030317 4.81% flagellated sperm motility
GO:0010604 4.80% positive regulation of macromolecule metabolic process
GO:0007606 4.80% sensory perception of chemical stimulus
GO:1902533 4.77% positive regulation of intracellular signal transduction
GO:0007187 4.76% G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0099177 4.76% regulation of trans-synaptic signaling
GO:0050801 4.75% ion homeostasis
GO:1901575 4.74% organic substance catabolic process
GO:0009056 4.73% catabolic process
GO:0007188 4.72% adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0048870 4.71% cell motility
GO:0022603 4.71% regulation of anatomical structure morphogenesis
GO:0043436 4.71% oxoacid metabolic process
GO:0051093 4.71% negative regulation of developmental process
GO:0009890 4.67% negative regulation of biosynthetic process
GO:0006066 4.66% alcohol metabolic process
GO:0055080 4.66% cation homeostasis
GO:0034641 4.63% cellular nitrogen compound metabolic process
GO:0009058 4.63% biosynthetic process
GO:0031325 4.62% positive regulation of cellular metabolic process
GO:0060285 4.61% cilium-dependent cell motility
GO:0032103 4.61% positive regulation of response to external stimulus
GO:0001501 4.59% skeletal system development
GO:0009266 4.59% response to temperature stimulus
GO:0050804 4.57% modulation of chemical synaptic transmission
GO:0051050 4.56% positive regulation of transport
GO:0019216 4.55% regulation of lipid metabolic process
GO:0051703 4.54% intraspecies interaction between organisms
GO:0008104 4.53% protein localization
GO:0009887 4.53% animal organ morphogenesis
GO:0051960 4.53% regulation of nervous system development
GO:0006082 4.52% organic acid metabolic process
GO:0033036 4.52% macromolecule localization
GO:0044267 4.52% cellular protein metabolic process
GO:0060548 4.52% negative regulation of cell death
GO:0006725 4.51% cellular aromatic compound metabolic process
GO:0019752 4.51% carboxylic acid metabolic process
GO:0001101 4.51% response to acid chemical
GO:0055065 4.50% metal ion homeostasis
GO:0019935 4.50% cyclic-nucleotide-mediated signaling
GO:0048511 4.49% rhythmic process
GO:0001932 4.48% regulation of protein phosphorylation
GO:0007283 4.48% spermatogenesis
GO:0051301 4.47% cell division
GO:0043412 4.46% macromolecule modification
GO:1901615 4.46% organic hydroxy compound metabolic process
GO:0048232 4.46% male gamete generation
GO:0045087 4.44% innate immune response
GO:0050890 4.43% cognition
GO:1901576 4.42% organic substance biosynthetic process
GO:0022607 4.41% cellular component assembly
GO:0045926 4.41% negative regulation of growth
GO:0007049 4.41% cell cycle
GO:1901701 4.41% cellular response to oxygen-containing compound
GO:2000243 4.40% positive regulation of reproductive process
GO:0000003 4.37% reproduction
GO:0006357 4.36% regulation of transcription by RNA polymerase II
GO:0031327 4.36% negative regulation of cellular biosynthetic process
GO:0007276 4.36% gamete generation
GO:0071705 4.35% nitrogen compound transport
GO:0010675 4.34% regulation of cellular carbohydrate metabolic process
GO:0007189 4.33% adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0019933 4.31% cAMP-mediated signaling
GO:0007626 4.30% locomotory behavior
GO:0019637 4.30% organophosphate metabolic process
GO:0051129 4.29% negative regulation of cellular component organization
GO:0031400 4.28% negative regulation of protein modification process
GO:0030334 4.28% regulation of cell migration
GO:0040013 4.27% negative regulation of locomotion
GO:0006464 4.27% cellular protein modification process
GO:0036211 4.26% protein modification process
GO:0009991 4.26% response to extracellular stimulus
GO:0016311 4.25% dephosphorylation
GO:0043269 4.24% regulation of ion transport
GO:0001701 4.24% in utero embryonic development
GO:0010629 4.24% negative regulation of gene expression
GO:0051341 4.23% regulation of oxidoreductase activity
GO:0006091 4.22% generation of precursor metabolites and energy
GO:0098609 4.20% cell-cell adhesion
GO:0031347 4.19% regulation of defense response
GO:0030030 4.19% cell projection organization
GO:0046677 4.17% response to antibiotic
GO:0051173 4.17% positive regulation of nitrogen compound metabolic process
GO:0043069 4.16% negative regulation of programmed cell death
GO:0006873 4.13% cellular ion homeostasis
GO:0031667 4.13% response to nutrient levels
GO:0044249 4.11% cellular biosynthetic process
GO:0045934 4.11% negative regulation of nucleobase-containing compound metabolic process
GO:0007586 4.10% digestion
GO:0043549 4.09% regulation of kinase activity
GO:0060284 4.09% regulation of cell development
GO:0002682 4.08% regulation of immune system process
GO:0051271 4.08% negative regulation of cellular component movement
GO:0008217 4.08% regulation of blood pressure
GO:0001817 4.08% regulation of cytokine production
GO:0051641 4.06% cellular localization
GO:0043009 4.06% chordate embryonic development
GO:0046483 4.04% heterocycle metabolic process
GO:0021700 4.03% developmental maturation
GO:0007601 4.02% visual perception
GO:0048509 4.01% regulation of meristem development
GO:0043066 4.00% negative regulation of apoptotic process
GO:0010565 4.00% regulation of cellular ketone metabolic process
GO:0044282 4.00% small molecule catabolic process
GO:0007611 4.00% learning or memory
GO:0010906 4.00% regulation of glucose metabolic process
GO:2000146 3.99% negative regulation of cell motility
GO:0030534 3.99% adult behavior
GO:0000902 3.97% cell morphogenesis
GO:0006996 3.97% organelle organization
GO:0008283 3.96% cell population proliferation
GO:0006974 3.96% cellular response to DNA damage stimulus
GO:0071496 3.96% cellular response to external stimulus
GO:0050953 3.96% sensory perception of light stimulus
GO:0042391 3.95% regulation of membrane potential
GO:0042742 3.95% defense response to bacterium
GO:0007399 3.95% nervous system development
GO:0043933 3.95% protein-containing complex subunit organization
GO:0031644 3.94% regulation of nervous system process
GO:0045597 3.93% positive regulation of cell differentiation
GO:0048638 3.93% regulation of developmental growth
GO:0007200 3.93% phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0031589 3.93% cell-substrate adhesion
GO:0008219 3.90% cell death
GO:0031647 3.90% regulation of protein stability
GO:0048640 3.90% negative regulation of developmental growth
GO:0033043 3.90% regulation of organelle organization
GO:0007169 3.87% transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042445 3.87% hormone metabolic process
GO:1901135 3.87% carbohydrate derivative metabolic process
GO:0080135 3.87% regulation of cellular response to stress
GO:0009651 3.86% response to salt stress
GO:0070482 3.86% response to oxygen levels
GO:0032787 3.85% monocarboxylic acid metabolic process
GO:0099536 3.85% synaptic signaling
GO:0071310 3.85% cellular response to organic substance
GO:0006869 3.84% lipid transport
GO:0050920 3.84% regulation of chemotaxis
GO:0000904 3.84% cell morphogenesis involved in differentiation
GO:0030162 3.83% regulation of proteolysis
GO:0055082 3.82% cellular chemical homeostasis
GO:0045596 3.82% negative regulation of cell differentiation
GO:0007168 3.82% receptor guanylyl cyclase signaling pathway
GO:0044764 3.81% multi-organism cellular process
GO:1901698 3.81% response to nitrogen compound
GO:0098916 3.81% anterograde trans-synaptic signaling
GO:0097306 3.81% cellular response to alcohol
GO:0030435 3.80% sporulation resulting in formation of a cellular spore
GO:0022402 3.80% cell cycle process
GO:0007010 3.79% cytoskeleton organization
GO:0030003 3.79% cellular cation homeostasis
GO:0045936 3.79% negative regulation of phosphate metabolic process
GO:0043408 3.78% regulation of MAPK cascade
GO:0007015 3.78% actin filament organization
GO:0007268 3.78% chemical synaptic transmission
GO:0051130 3.77% positive regulation of cellular component organization
GO:0008610 3.77% lipid biosynthetic process
GO:0007608 3.76% sensory perception of smell
GO:0071478 3.76% cellular response to radiation
GO:0044262 3.76% cellular carbohydrate metabolic process
GO:0007605 3.76% sensory perception of sound
GO:0090257 3.76% regulation of muscle system process
GO:0001558 3.75% regulation of cell growth
GO:0044089 3.75% positive regulation of cellular component biogenesis
GO:0051253 3.75% negative regulation of RNA metabolic process
GO:2000113 3.75% negative regulation of cellular macromolecule biosynthetic process
GO:0010558 3.75% negative regulation of macromolecule biosynthetic process
GO:0090092 3.75% regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048167 3.75% regulation of synaptic plasticity
GO:0019318 3.75% hexose metabolic process
GO:0005996 3.74% monosaccharide metabolic process
GO:0006139 3.74% nucleobase-containing compound metabolic process
GO:0012501 3.74% programmed cell death
GO:0009636 3.74% response to toxic substance
GO:0007389 3.74% pattern specification process
GO:0007017 3.73% microtubule-based process
GO:0071482 3.72% cellular response to light stimulus
GO:0019722 3.72% calcium-mediated signaling
GO:0110149 3.72% regulation of biomineralization
GO:0031349 3.71% positive regulation of defense response
GO:0010942 3.71% positive regulation of cell death
GO:0065003 3.70% protein-containing complex assembly
GO:1903831 3.70% signal transduction involved in cellular response to ammonium ion
GO:0006644 3.70% phospholipid metabolic process
GO:0043901 3.70% negative regulation of multi-organism process
GO:0006875 3.70% cellular metal ion homeostasis
GO:0099537 3.70% trans-synaptic signaling
GO:0071241 3.68% cellular response to inorganic substance
GO:0046889 3.68% positive regulation of lipid biosynthetic process
GO:0044283 3.68% small molecule biosynthetic process
GO:0007420 3.68% brain development
GO:0034285 3.67% response to disaccharide
GO:0010563 3.67% negative regulation of phosphorus metabolic process
GO:0007623 3.67% circadian rhythm
GO:0019098 3.66% reproductive behavior
GO:0009611 3.66% response to wounding
GO:0006457 3.65% protein folding
GO:0006468 3.65% protein phosphorylation
GO:0050954 3.64% sensory perception of mechanical stimulus
GO:0099402 3.64% plant organ development
GO:0007568 3.64% aging
GO:0006979 3.64% response to oxidative stress
GO:0002250 3.64% adaptive immune response
GO:0045834 3.63% positive regulation of lipid metabolic process
GO:0006972 3.62% hyperosmotic response
GO:0010608 3.62% posttranscriptional regulation of gene expression
GO:0008344 3.61% adult locomotory behavior
GO:0045184 3.60% establishment of protein localization
GO:0001894 3.60% tissue homeostasis
GO:0048580 3.60% regulation of post-embryonic development
GO:0006935 3.60% chemotaxis
GO:0051345 3.60% positive regulation of hydrolase activity
GO:0045859 3.60% regulation of protein kinase activity
GO:0043934 3.59% sporulation
GO:0009408 3.59% response to heat
GO:0045937 3.58% positive regulation of phosphate metabolic process
GO:0015698 3.58% inorganic anion transport
GO:0009744 3.57% response to sucrose
GO:0006820 3.57% anion transport
GO:0046578 3.56% regulation of Ras protein signal transduction
GO:0030258 3.56% lipid modification
GO:0051348 3.56% negative regulation of transferase activity
GO:0044248 3.56% cellular catabolic process
GO:0010562 3.56% positive regulation of phosphorus metabolic process
GO:0036293 3.55% response to decreased oxygen levels
GO:0009894 3.55% regulation of catabolic process
GO:0051056 3.55% regulation of small GTPase mediated signal transduction
GO:0050909 3.55% sensory perception of taste
GO:0001505 3.54% regulation of neurotransmitter levels
GO:0043068 3.54% positive regulation of programmed cell death
GO:0034248 3.54% regulation of cellular amide metabolic process
GO:0072507 3.54% divalent inorganic cation homeostasis
GO:0009581 3.53% detection of external stimulus
GO:0060560 3.53% developmental growth involved in morphogenesis
GO:0009583 3.53% detection of light stimulus
GO:0009410 3.53% response to xenobiotic stimulus
GO:0050807 3.53% regulation of synapse organization
GO:0008643 3.53% carbohydrate transport
GO:0035176 3.52% social behavior
GO:0006959 3.52% humoral immune response
GO:0048598 3.51% embryonic morphogenesis
GO:0016192 3.50% vesicle-mediated transport
GO:0042327 3.49% positive regulation of phosphorylation
GO:0032881 3.49% regulation of polysaccharide metabolic process
GO:0031329 3.49% regulation of cellular catabolic process
GO:0010469 3.48% regulation of signaling receptor activity
GO:0042330 3.48% taxis
GO:0051346 3.47% negative regulation of hydrolase activity
GO:0010959 3.46% regulation of metal ion transport
GO:0001666 3.46% response to hypoxia
GO:0043065 3.46% positive regulation of apoptotic process
GO:0051726 3.45% regulation of cell cycle
GO:0009582 3.45% detection of abiotic stimulus
GO:0048831 3.45% regulation of shoot system development
GO:0051604 3.45% protein maturation
GO:0046488 3.44% phosphatidylinositol metabolic process
GO:0061077 3.44% chaperone-mediated protein folding
GO:0097435 3.44% supramolecular fiber organization
GO:0000160 3.43% phosphorelay signal transduction system
GO:0031668 3.43% cellular response to extracellular stimulus
GO:0016052 3.42% carbohydrate catabolic process
GO:0015833 3.42% peptide transport
GO:0016053 3.42% organic acid biosynthetic process
GO:0030855 3.42% epithelial cell differentiation
GO:0042752 3.42% regulation of circadian rhythm
GO:0050767 3.42% regulation of neurogenesis
GO:0032880 3.41% regulation of protein localization
GO:0042886 3.41% amide transport
GO:0070167 3.41% regulation of biomineral tissue development
GO:0006006 3.40% glucose metabolic process
GO:0044419 3.39% interspecies interaction between organisms
GO:0043410 3.39% positive regulation of MAPK cascade
GO:1902532 3.39% negative regulation of intracellular signal transduction
GO:0046903 3.39% secretion
GO:0048588 3.39% developmental cell growth
GO:0010628 3.38% positive regulation of gene expression
GO:0035303 3.38% regulation of dephosphorylation
GO:0055074 3.38% calcium ion homeostasis
GO:0060249 3.38% anatomical structure homeostasis
GO:0046854 3.38% phosphatidylinositol phosphorylation
GO:0051046 3.38% regulation of secretion
GO:0042594 3.37% response to starvation
GO:0050795 3.37% regulation of behavior
GO:0002831 3.36% regulation of response to biotic stimulus
GO:0016049 3.36% cell growth
GO:0008285 3.36% negative regulation of cell population proliferation
GO:0032102 3.36% negative regulation of response to external stimulus
GO:0003002 3.36% regionalization
GO:0043467 3.36% regulation of generation of precursor metabolites and energy
GO:0010243 3.35% response to organonitrogen compound
GO:0022604 3.35% regulation of cell morphogenesis
GO:0007204 3.34% positive regulation of cytosolic calcium ion concentration
GO:0007617 3.34% mating behavior
GO:0051302 3.34% regulation of cell division
GO:0043122 3.33% regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048364 3.33% root development
GO:0001819 3.32% positive regulation of cytokine production
GO:0051493 3.32% regulation of cytoskeleton organization
GO:0009415 3.32% response to water
GO:0051480 3.32% regulation of cytosolic calcium ion concentration
GO:0000910 3.31% cytokinesis
GO:0090287 3.31% regulation of cellular response to growth factor stimulus
GO:0006650 3.31% glycerophospholipid metabolic process
GO:0009914 3.31% hormone transport
GO:0071695 3.30% anatomical structure maturation
GO:0071495 3.30% cellular response to endogenous stimulus
GO:0019730 3.30% antimicrobial humoral response
GO:1901654 3.30% response to ketone
GO:0034762 3.29% regulation of transmembrane transport
GO:0051247 3.29% positive regulation of protein metabolic process
GO:0006508 3.29% proteolysis
GO:0030336 3.29% negative regulation of cell migration
GO:0032990 3.28% cell part morphogenesis
GO:0097164 3.28% ammonium ion metabolic process
GO:0015031 3.28% protein transport
GO:0030155 3.26% regulation of cell adhesion
GO:0022898 3.26% regulation of transmembrane transporter activity
GO:0009642 3.25% response to light intensity
GO:0032409 3.25% regulation of transporter activity
GO:0009268 3.25% response to pH
GO:0008286 3.25% insulin receptor signaling pathway
GO:1901565 3.24% organonitrogen compound catabolic process
GO:0009414 3.24% response to water deprivation
GO:0006470 3.24% protein dephosphorylation
GO:0030500 3.24% regulation of bone mineralization
GO:0016042 3.24% lipid catabolic process
GO:0033673 3.24% negative regulation of kinase activity
GO:0050821 3.23% protein stabilization
GO:0051606 3.23% detection of stimulus
GO:0046394 3.23% carboxylic acid biosynthetic process
GO:0045892 3.22% negative regulation of transcription, DNA-templated
GO:0046834 3.22% lipid phosphorylation
GO:0001933 3.22% negative regulation of protein phosphorylation
GO:0043255 3.22% regulation of carbohydrate biosynthetic process
GO:0042326 3.22% negative regulation of phosphorylation
GO:0031669 3.22% cellular response to nutrient levels
GO:0007635 3.21% chemosensory behavior
GO:0098657 3.21% import into cell
GO:0055114 3.20% oxidation-reduction process
GO:0051259 3.20% protein complex oligomerization
GO:1902679 3.20% negative regulation of RNA biosynthetic process
GO:0051347 3.20% positive regulation of transferase activity
GO:0034754 3.20% cellular hormone metabolic process
GO:1900271 3.20% regulation of long-term synaptic potentiation
GO:0071236 3.20% cellular response to antibiotic
GO:0051353 3.19% positive regulation of oxidoreductase activity
GO:0051705 3.19% multi-organism behavior
GO:1903507 3.19% negative regulation of nucleic acid-templated transcription
GO:0006937 3.19% regulation of muscle contraction
GO:2000280 3.19% regulation of root development
GO:0099120 3.19% socially cooperative development
GO:0006915 3.18% apoptotic process
GO:0006812 3.18% cation transport
GO:0045598 3.18% regulation of fat cell differentiation
GO:0043254 3.18% regulation of protein complex assembly
GO:0009411 3.18% response to UV
GO:0008202 3.17% steroid metabolic process
GO:0019954 3.17% asexual reproduction
GO:0090288 3.17% negative regulation of cellular response to growth factor stimulus
GO:0008277 3.17% regulation of G protein-coupled receptor signaling pathway
GO:0120039 3.17% plasma membrane bounded cell projection morphogenesis
GO:0006417 3.17% regulation of translation
GO:0048858 3.17% cell projection morphogenesis
GO:0120161 3.16% regulation of cold-induced thermogenesis
GO:0007632 3.16% visual behavior
GO:0051339 3.16% regulation of lyase activity
GO:0007602 3.15% phototransduction
GO:0044070 3.15% regulation of anion transport
GO:1903530 3.15% regulation of secretion by cell
GO:0080154 3.14% regulation of fertilization
GO:0050817 3.14% coagulation
GO:0006874 3.14% cellular calcium ion homeostasis
GO:0030001 3.14% metal ion transport
GO:0006936 3.13% muscle contraction
GO:0090304 3.13% nucleic acid metabolic process
GO:0016477 3.13% cell migration
GO:0040017 3.12% positive regulation of locomotion
GO:0071453 3.11% cellular response to oxygen levels
GO:0048729 3.11% tissue morphogenesis
GO:0051051 3.10% negative regulation of transport
GO:0048812 3.10% neuron projection morphogenesis
GO:0072347 3.10% response to anesthetic
GO:0062014 3.10% negative regulation of small molecule metabolic process
GO:0030029 3.09% actin filament-based process
GO:0051962 3.09% positive regulation of nervous system development
GO:0070372 3.09% regulation of ERK1 and ERK2 cascade
GO:0034599 3.09% cellular response to oxidative stress
GO:0007612 3.09% learning
GO:0006469 3.08% negative regulation of protein kinase activity
GO:0008306 3.08% associative learning
GO:0032412 3.08% regulation of ion transmembrane transporter activity
GO:0050776 3.08% regulation of immune response
GO:0001934 3.08% positive regulation of protein phosphorylation
GO:0071456 3.07% cellular response to hypoxia
GO:0071467 3.07% cellular response to pH
GO:0019751 3.07% polyol metabolic process
GO:0030308 3.07% negative regulation of cell growth
GO:0006954 3.06% inflammatory response
GO:0036294 3.06% cellular response to decreased oxygen levels
GO:1905952 3.06% regulation of lipid localization
GO:0009891 3.06% positive regulation of biosynthetic process
GO:0022412 3.06% cellular process involved in reproduction in multicellular organism
GO:0030278 3.05% regulation of ossification
GO:0095500 3.05% acetylcholine receptor signaling pathway
GO:1903426 3.04% regulation of reactive oxygen species biosynthetic process
GO:0017144 3.04% drug metabolic process
GO:0007599 3.04% hemostasis
GO:0050806 3.03% positive regulation of synaptic transmission
GO:0048468 3.03% cell development
GO:2000377 3.03% regulation of reactive oxygen species metabolic process
GO:0120036 3.03% plasma membrane bounded cell projection organization
GO:0071229 3.03% cellular response to acid chemical
GO:0006631 3.03% fatty acid metabolic process
GO:0008340 3.02% determination of adult lifespan
GO:0090066 3.02% regulation of anatomical structure size
GO:0051272 3.01% positive regulation of cellular component movement
GO:1903998 3.01% regulation of eating behavior
GO:0098742 3.01% cell-cell adhesion via plasma-membrane adhesion molecules
GO:0051592 3.00% response to calcium ion
GO:0003013 3.00% circulatory system process
GO:0031214 2.99% biomineral tissue development
GO:0022600 2.99% digestive system process
GO:0052547 2.98% regulation of peptidase activity
GO:0009409 2.98% response to cold
GO:0046486 2.97% glycerolipid metabolic process
GO:0009401 2.96% phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0045935 2.96% positive regulation of nucleobase-containing compound metabolic process
GO:0042446 2.95% hormone biosynthetic process
GO:0072503 2.95% cellular divalent inorganic cation homeostasis
GO:0060390 2.95% regulation of SMAD protein signal transduction
GO:0044703 2.95% multi-organism reproductive process
GO:0032270 2.94% positive regulation of cellular protein metabolic process
GO:0055085 2.94% transmembrane transport
GO:0010286 2.94% heat acclimation
GO:2000147 2.94% positive regulation of cell motility
GO:0002684 2.93% positive regulation of immune system process
GO:0048469 2.93% cell maturation
GO:0070873 2.93% regulation of glycogen metabolic process
GO:0090101 2.93% negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045913 2.93% positive regulation of carbohydrate metabolic process
GO:1903047 2.93% mitotic cell cycle process
GO:0031279 2.92% regulation of cyclase activity
GO:0019827 2.91% stem cell population maintenance
GO:0002833 2.91% positive regulation of response to biotic stimulus
GO:0097190 2.90% apoptotic signaling pathway
GO:0098727 2.90% maintenance of cell number
GO:0007266 2.90% Rho protein signal transduction
GO:0006897 2.90% endocytosis
GO:0031401 2.90% positive regulation of protein modification process
GO:0043270 2.90% positive regulation of ion transport
GO:0043588 2.90% skin development
GO:0031099 2.90% regeneration
GO:0007507 2.89% heart development
GO:0016051 2.89% carbohydrate biosynthetic process
GO:0045088 2.89% regulation of innate immune response
GO:0007212 2.89% dopamine receptor signaling pathway
GO:0042737 2.88% drug catabolic process
GO:0050878 2.88% regulation of body fluid levels
GO:0035690 2.88% cellular response to drug
GO:0034765 2.88% regulation of ion transmembrane transport
GO:1901616 2.88% organic hydroxy compound catabolic process
GO:0022404 2.87% molting cycle process
GO:0010447 2.87% response to acidic pH
GO:0007584 2.87% response to nutrient
GO:0035304 2.87% regulation of protein dephosphorylation
GO:1901566 2.87% organonitrogen compound biosynthetic process
GO:0009873 2.87% ethylene-activated signaling pathway
GO:0030182 2.86% neuron differentiation
GO:0000226 2.86% microtubule cytoskeleton organization
GO:0015850 2.86% organic hydroxy compound transport
GO:0090407 2.86% organophosphate biosynthetic process
GO:0043603 2.86% cellular amide metabolic process
GO:0044403 2.86% symbiotic process
GO:0007264 2.85% small GTPase mediated signal transduction
GO:0002009 2.85% morphogenesis of an epithelium
GO:0015980 2.85% energy derivation by oxidation of organic compounds
GO:0110148 2.85% biomineralization
GO:0006909 2.85% phagocytosis
GO:0035821 2.85% modification of morphology or physiology of other organism
GO:2000242 2.84% negative regulation of reproductive process
GO:0016101 2.84% diterpenoid metabolic process
GO:0009740 2.83% gibberellic acid mediated signaling pathway
GO:0048534 2.83% hematopoietic or lymphoid organ development
GO:0070727 2.83% cellular macromolecule localization
GO:0071248 2.83% cellular response to metal ion
GO:0030097 2.83% hemopoiesis
GO:0009734 2.83% auxin-activated signaling pathway
GO:0051930 2.82% regulation of sensory perception of pain
GO:0010921 2.82% regulation of phosphatase activity
GO:0046034 2.82% ATP metabolic process
GO:0060348 2.81% bone development
GO:0003012 2.81% muscle system process
GO:0009733 2.81% response to auxin
GO:0140352 2.81% export from cell
GO:0010721 2.80% negative regulation of cell development
GO:0060341 2.80% regulation of cellular localization
GO:0045777 2.80% positive regulation of blood pressure
GO:0050905 2.79% neuromuscular process
GO:0009743 2.79% response to carbohydrate
GO:0010676 2.79% positive regulation of cellular carbohydrate metabolic process
GO:0010639 2.79% negative regulation of organelle organization
GO:0071468 2.79% cellular response to acidic pH
GO:0006325 2.78% chromatin organization
GO:0051961 2.78% negative regulation of nervous system development
GO:0043401 2.78% steroid hormone mediated signaling pathway
GO:0098926 2.78% postsynaptic signal transduction
GO:0050854 2.78% regulation of antigen receptor-mediated signaling pathway
GO:0051963 2.78% regulation of synapse assembly
GO:0008544 2.78% epidermis development
GO:0019221 2.78% cytokine-mediated signaling pathway
GO:2000024 2.78% regulation of leaf development
GO:1901699 2.77% cellular response to nitrogen compound
GO:0002685 2.77% regulation of leukocyte migration
GO:0008542 2.77% visual learning
GO:0055086 2.77% nucleobase-containing small molecule metabolic process
GO:0098743 2.77% cell aggregation
GO:0072593 2.76% reactive oxygen species metabolic process
GO:1901362 2.76% organic cyclic compound biosynthetic process
GO:0045833 2.76% negative regulation of lipid metabolic process
GO:0000122 2.76% negative regulation of transcription by RNA polymerase II
GO:0034613 2.75% cellular protein localization
GO:0060259 2.75% regulation of feeding behavior
GO:0051931 2.75% regulation of sensory perception
GO:0072330 2.75% monocarboxylic acid biosynthetic process
GO:0046164 2.75% alcohol catabolic process
GO:0007162 2.75% negative regulation of cell adhesion
GO:0007265 2.75% Ras protein signal transduction
GO:0070647 2.74% protein modification by small protein conjugation or removal
GO:0043123 2.74% positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0030198 2.73% extracellular matrix organization
GO:0033238 2.73% regulation of cellular amine metabolic process
GO:0071900 2.71% regulation of protein serine/threonine kinase activity
GO:0055076 2.71% transition metal ion homeostasis
GO:0045444 2.71% fat cell differentiation
GO:0030335 2.71% positive regulation of cell migration
GO:0032446 2.71% protein modification by small protein conjugation
GO:0019236 2.71% response to pheromone
GO:0032885 2.71% regulation of polysaccharide biosynthetic process
GO:0007613 2.71% memory
GO:1901214 2.70% regulation of neuron death
GO:0031328 2.70% positive regulation of cellular biosynthetic process
GO:0032940 2.70% secretion by cell
GO:0006753 2.69% nucleoside phosphate metabolic process
GO:0009117 2.69% nucleotide metabolic process
GO:0008406 2.69% gonad development
GO:0006898 2.68% receptor-mediated endocytosis
GO:0030036 2.68% actin cytoskeleton organization
GO:0007423 2.68% sensory organ development
GO:0001649 2.68% osteoblast differentiation
GO:0043455 2.68% regulation of secondary metabolic process
GO:0032535 2.68% regulation of cellular component size
GO:0000302 2.68% response to reactive oxygen species
GO:0009312 2.68% oligosaccharide biosynthetic process
GO:0007218 2.67% neuropeptide signaling pathway
GO:0046907 2.67% intracellular transport
GO:0010476 2.67% gibberellin mediated signaling pathway
GO:0045761 2.67% regulation of adenylate cyclase activity
GO:0033674 2.67% positive regulation of kinase activity
GO:1903844 2.67% regulation of cellular response to transforming growth factor beta stimulus
GO:0043266 2.66% regulation of potassium ion transport
GO:0010564 2.66% regulation of cell cycle process
GO:0009267 2.65% cellular response to starvation
GO:0070374 2.65% positive regulation of ERK1 and ERK2 cascade
GO:0061024 2.65% membrane organization
GO:0034644 2.64% cellular response to UV
GO:0050727 2.64% regulation of inflammatory response
GO:0042447 2.64% hormone catabolic process
GO:0071470 2.64% cellular response to osmotic stress
GO:0019693 2.64% ribose phosphate metabolic process
GO:0071396 2.64% cellular response to lipid
GO:0043062 2.63% extracellular structure organization
GO:0046999 2.63% regulation of conjugation
GO:0043087 2.63% regulation of GTPase activity
GO:0048520 2.63% positive regulation of behavior
GO:0062013 2.63% positive regulation of small molecule metabolic process
GO:0009612 2.62% response to mechanical stimulus
GO:0001708 2.62% cell fate specification
GO:0050921 2.62% positive regulation of chemotaxis
GO:0044706 2.62% multi-multicellular organism process
GO:0000281 2.62% mitotic cytokinesis
GO:0002683 2.61% negative regulation of immune system process
GO:1905954 2.61% positive regulation of lipid localization
GO:0045785 2.61% positive regulation of cell adhesion
GO:0031348 2.61% negative regulation of defense response
GO:0048562 2.61% embryonic organ morphogenesis
GO:0034109 2.60% homotypic cell-cell adhesion
GO:0031175 2.60% neuron projection development
GO:0043487 2.60% regulation of RNA stability
GO:0045861 2.60% negative regulation of proteolysis
GO:0009639 2.59% response to red or far red light
GO:0051656 2.59% establishment of organelle localization
GO:1903827 2.59% regulation of cellular protein localization
GO:0016032 2.58% viral process
GO:0048678 2.58% response to axon injury
GO:0031344 2.58% regulation of cell projection organization
GO:0007059 2.58% chromosome segregation
GO:0009860 2.58% pollen tube growth
GO:1903311 2.58% regulation of mRNA metabolic process
GO:0009615 2.58% response to virus
GO:0051091 2.58% positive regulation of DNA-binding transcription factor activity
GO:0009826 2.58% unidimensional cell growth
GO:2000649 2.58% regulation of sodium ion transmembrane transporter activity
GO:0051640 2.57% organelle localization
GO:0019748 2.57% secondary metabolic process
GO:0023061 2.57% signal release
GO:0048705 2.57% skeletal system morphogenesis
GO:0007596 2.57% blood coagulation
GO:0120162 2.56% positive regulation of cold-induced thermogenesis
GO:0009566 2.56% fertilization
GO:0016070 2.55% RNA metabolic process
GO:0009308 2.55% amine metabolic process
GO:0044271 2.55% cellular nitrogen compound biosynthetic process
GO:0030216 2.55% keratinocyte differentiation
GO:0051090 2.54% regulation of DNA-binding transcription factor activity
GO:0043547 2.54% positive regulation of GTPase activity
GO:0009737 2.54% response to abscisic acid
GO:0032094 2.54% response to food
GO:0001667 2.54% ameboidal-type cell migration
GO:0017015 2.54% regulation of transforming growth factor beta receptor signaling pathway
GO:0009793 2.54% embryo development ending in seed dormancy
GO:0031554 2.54% regulation of DNA-templated transcription, termination
GO:0034622 2.54% cellular protein-containing complex assembly
GO:0061572 2.53% actin filament bundle organization
GO:0009886 2.53% post-embryonic animal morphogenesis
GO:0002252 2.53% immune effector process
GO:0006633 2.53% fatty acid biosynthetic process
GO:0042133 2.52% neurotransmitter metabolic process
GO:0032355 2.52% response to estradiol
GO:0061640 2.52% cytoskeleton-dependent cytokinesis
GO:0045664 2.52% regulation of neuron differentiation
GO:1902930 2.51% regulation of alcohol biosynthetic process
GO:2000379 2.51% positive regulation of reactive oxygen species metabolic process
GO:1902305 2.51% regulation of sodium ion transmembrane transport
GO:0030324 2.51% lung development
GO:0048545 2.51% response to steroid hormone
GO:0060359 2.51% response to ammonium ion
GO:0034220 2.50% ion transmembrane transport
GO:0016054 2.50% organic acid catabolic process
GO:0009649 2.50% entrainment of circadian clock
GO:0046395 2.50% carboxylic acid catabolic process
GO:0010087 2.50% phloem or xylem histogenesis
GO:0050810 2.50% regulation of steroid biosynthetic process
GO:0045454 2.50% cell redox homeostasis
GO:0007631 2.49% feeding behavior
GO:0032970 2.49% regulation of actin filament-based process
GO:0008630 2.49% intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902652 2.49% secondary alcohol metabolic process
GO:0043112 2.49% receptor metabolic process
GO:0031424 2.49% keratinization
GO:1900076 2.49% regulation of cellular response to insulin stimulus
GO:0018149 2.49% peptide cross-linking
GO:0051321 2.49% meiotic cell cycle
GO:0099175 2.48% regulation of postsynapse organization
GO:0071407 2.48% cellular response to organic cyclic compound
GO:0022411 2.48% cellular component disassembly
GO:0042048 2.48% olfactory behavior
GO:0032368 2.48% regulation of lipid transport
GO:0009932 2.48% cell tip growth
GO:0097193 2.48% intrinsic apoptotic signaling pathway
GO:0007589 2.48% body fluid secretion
GO:0110150 2.48% negative regulation of biomineralization
GO:0030111 2.47% regulation of Wnt signaling pathway
GO:0018958 2.47% phenol-containing compound metabolic process
GO:0035023 2.47% regulation of Rho protein signal transduction
GO:0022405 2.47% hair cycle process
GO:0001523 2.47% retinoid metabolic process
GO:2001020 2.47% regulation of response to DNA damage stimulus
GO:0031137 2.47% regulation of conjugation with cellular fusion
GO:0001775 2.47% cell activation
GO:0031623 2.47% receptor internalization
GO:1901652 2.46% response to peptide
GO:1904062 2.46% regulation of cation transmembrane transport
GO:0007409 2.46% axonogenesis
GO:1901605 2.46% alpha-amino acid metabolic process
GO:0051047 2.45% positive regulation of secretion
GO:0010720 2.45% positive regulation of cell development
GO:0034308 2.45% primary alcohol metabolic process
GO:0009913 2.45% epidermal cell differentiation
GO:1903427 2.45% negative regulation of reactive oxygen species biosynthetic process
GO:0009644 2.45% response to high light intensity
GO:0006520 2.45% cellular amino acid metabolic process
GO:0010669 2.45% epithelial structure maintenance
GO:0045165 2.44% cell fate commitment
GO:0034614 2.44% cellular response to reactive oxygen species
GO:0006643 2.44% membrane lipid metabolic process
GO:0060627 2.44% regulation of vesicle-mediated transport
GO:2001023 2.44% regulation of response to drug
GO:0043271 2.43% negative regulation of ion transport
GO:0071417 2.43% cellular response to organonitrogen compound
GO:0051781 2.43% positive regulation of cell division
GO:0009259 2.43% ribonucleotide metabolic process
GO:0009648 2.43% photoperiodism
GO:0050832 2.43% defense response to fungus
GO:0045927 2.43% positive regulation of growth
GO:0009311 2.43% oligosaccharide metabolic process
GO:0045912 2.43% negative regulation of carbohydrate metabolic process
GO:2000107 2.42% negative regulation of leukocyte apoptotic process
GO:0051048 2.42% negative regulation of secretion
GO:0050885 2.42% neuromuscular process controlling balance
GO:1901361 2.42% organic cyclic compound catabolic process
GO:0034764 2.42% positive regulation of transmembrane transport
GO:0010638 2.42% positive regulation of organelle organization
GO:0051098 2.41% regulation of binding
GO:0007249 2.41% I-kappaB kinase/NF-kappaB signaling
GO:0001906 2.41% cell killing
GO:1901342 2.41% regulation of vasculature development
GO:0009059 2.41% macromolecule biosynthetic process
GO:0035264 2.40% multicellular organism growth
GO:0045600 2.40% positive regulation of fat cell differentiation
GO:0007417 2.40% central nervous system development
GO:0051954 2.40% positive regulation of amine transport
GO:0008360 2.40% regulation of cell shape
GO:0046174 2.39% polyol catabolic process
GO:0019217 2.39% regulation of fatty acid metabolic process
GO:0002244 2.39% hematopoietic progenitor cell differentiation
GO:0045765 2.39% regulation of angiogenesis
GO:0097237 2.38% cellular response to toxic substance
GO:0002688 2.38% regulation of leukocyte chemotaxis
GO:0046365 2.38% monosaccharide catabolic process
GO:0070507 2.38% regulation of microtubule cytoskeleton organization
GO:0034645 2.38% cellular macromolecule biosynthetic process
GO:0002274 2.38% myeloid leukocyte activation
GO:0010043 2.38% response to zinc ion
GO:0070542 2.38% response to fatty acid
GO:1901606 2.37% alpha-amino acid catabolic process
GO:0051952 2.37% regulation of amine transport
GO:1903522 2.37% regulation of blood circulation
GO:0050768 2.37% negative regulation of neurogenesis
GO:1903725 2.37% regulation of phospholipid metabolic process
GO:0040014 2.37% regulation of multicellular organism growth
GO:0008584 2.37% male gonad development
GO:0032465 2.37% regulation of cytokinesis
GO:0009896 2.36% positive regulation of catabolic process
GO:0007638 2.36% mechanosensory behavior
GO:0045893 2.36% positive regulation of transcription, DNA-templated
GO:0006939 2.36% smooth muscle contraction
GO:0016567 2.36% protein ubiquitination
GO:0050766 2.36% positive regulation of phagocytosis
GO:0010962 2.35% regulation of glucan biosynthetic process
GO:0046883 2.35% regulation of hormone secretion
GO:0001818 2.35% negative regulation of cytokine production
GO:0009620 2.35% response to fungus
GO:0009895 2.35% negative regulation of catabolic process
GO:0032104 2.35% regulation of response to extracellular stimulus
GO:0043666 2.35% regulation of phosphoprotein phosphatase activity
GO:0050679 2.35% positive regulation of epithelial cell proliferation
GO:0001763 2.35% morphogenesis of a branching structure
GO:0010042 2.35% response to manganese ion
GO:0070527 2.34% platelet aggregation
GO:1902680 2.34% positive regulation of RNA biosynthetic process
GO:0045786 2.34% negative regulation of cell cycle
GO:0051649 2.34% establishment of localization in cell
GO:0032350 2.33% regulation of hormone metabolic process
GO:0071472 2.33% cellular response to salt stress
GO:0010557 2.33% positive regulation of macromolecule biosynthetic process
GO:0035308 2.33% negative regulation of protein dephosphorylation
GO:0051084 2.33% 'de novo' posttranslational protein folding
GO:0072657 2.33% protein localization to membrane
GO:0010810 2.32% regulation of cell-substrate adhesion
GO:0043244 2.32% regulation of protein complex disassembly
GO:0034605 2.32% cellular response to heat
GO:0042476 2.32% odontogenesis
GO:0008654 2.32% phospholipid biosynthetic process
GO:1903508 2.32% positive regulation of nucleic acid-templated transcription
GO:0009798 2.32% axis specification
GO:0019320 2.32% hexose catabolic process
GO:0031047 2.32% gene silencing by RNA
GO:0051254 2.32% positive regulation of RNA metabolic process
GO:1990778 2.32% protein localization to cell periphery
GO:0034763 2.32% negative regulation of transmembrane transport
GO:1903532 2.31% positive regulation of secretion by cell
GO:0044060 2.31% regulation of endocrine process
GO:0048581 2.31% negative regulation of post-embryonic development
GO:0002686 2.31% negative regulation of leukocyte migration
GO:0051591 2.31% response to cAMP
GO:0007346 2.31% regulation of mitotic cell cycle
GO:0061844 2.31% antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0048015 2.30% phosphatidylinositol-mediated signaling
GO:0019218 2.30% regulation of steroid metabolic process
GO:0052548 2.30% regulation of endopeptidase activity
GO:0055072 2.30% iron ion homeostasis
GO:0033273 2.29% response to vitamin
GO:0001895 2.29% retina homeostasis
GO:0006953 2.29% acute-phase response
GO:0008652 2.29% cellular amino acid biosynthetic process
GO:0045321 2.29% leukocyte activation
GO:0048872 2.29% homeostasis of number of cells
GO:0051055 2.28% negative regulation of lipid biosynthetic process
GO:0010466 2.28% negative regulation of peptidase activity
GO:0006396 2.28% RNA processing
GO:0034695 2.28% response to prostaglandin E
GO:0050829 2.28% defense response to Gram-negative bacterium
GO:0009909 2.28% regulation of flower development
GO:0030307 2.28% positive regulation of cell growth
GO:0048582 2.28% positive regulation of post-embryonic development
GO:0050678 2.27% regulation of epithelial cell proliferation
GO:0019438 2.27% aromatic compound biosynthetic process
GO:0007005 2.27% mitochondrion organization
GO:0044364 2.27% disruption of cells of other organism
GO:0001525 2.27% angiogenesis
GO:0042180 2.27% cellular ketone metabolic process
GO:0051817 2.27% modification of morphology or physiology of other organism involved in symbiotic interaction
GO:0048145 2.27% regulation of fibroblast proliferation
GO:0048017 2.26% inositol lipid-mediated signaling
GO:0045667 2.26% regulation of osteoblast differentiation
GO:0031929 2.26% TOR signaling
GO:0098630 2.26% aggregation of unicellular organisms
GO:0006338 2.26% chromatin remodeling
GO:0035305 2.25% negative regulation of dephosphorylation
GO:0051924 2.25% regulation of calcium ion transport
GO:0031640 2.25% killing of cells of other organism
GO:0046916 2.25% cellular transition metal ion homeostasis
GO:0006112 2.25% energy reserve metabolic process
GO:1901215 2.25% negative regulation of neuron death
GO:0008037 2.25% cell recognition
GO:1903793 2.25% positive regulation of anion transport
GO:0010827 2.25% regulation of glucose transmembrane transport
GO:0006099 2.24% tricarboxylic acid cycle
GO:0031333 2.24% negative regulation of protein complex assembly
GO:0009880 2.24% embryonic pattern specification
GO:0046879 2.24% hormone secretion
GO:1901617 2.24% organic hydroxy compound biosynthetic process
GO:0050769 2.24% positive regulation of neurogenesis
GO:0003014 2.23% renal system process
GO:0001890 2.23% placenta development
GO:1900273 2.23% positive regulation of long-term synaptic potentiation
GO:0032870 2.23% cellular response to hormone stimulus
GO:0072521 2.23% purine-containing compound metabolic process
GO:0005976 2.23% polysaccharide metabolic process
GO:0006721 2.23% terpenoid metabolic process
GO:0070229 2.23% negative regulation of lymphocyte apoptotic process
GO:0014074 2.23% response to purine-containing compound
GO:0032107 2.22% regulation of response to nutrient levels
GO:0051156 2.22% glucose 6-phosphate metabolic process
GO:0050778 2.22% positive regulation of immune response
GO:0070925 2.22% organelle assembly
GO:0009723 2.22% response to ethylene
GO:0002028 2.22% regulation of sodium ion transport
GO:0018209 2.22% peptidyl-serine modification
GO:0060537 2.22% muscle tissue development
GO:0007009 2.22% plasma membrane organization
GO:0090087 2.22% regulation of peptide transport
GO:0030522 2.22% intracellular receptor signaling pathway
GO:0018130 2.21% heterocycle biosynthetic process
GO:0031032 2.21% actomyosin structure organization
GO:0090596 2.20% sensory organ morphogenesis
GO:0042060 2.20% wound healing
GO:0022407 2.20% regulation of cell-cell adhesion
GO:0019400 2.20% alditol metabolic process
GO:0051968 2.20% positive regulation of synaptic transmission, glutamatergic
GO:0010631 2.20% epithelial cell migration
GO:0015711 2.20% organic anion transport
GO:0048857 2.20% neural nucleus development
GO:1903959 2.19% regulation of anion transmembrane transport
GO:0031334 2.19% positive regulation of protein complex assembly
GO:0051235 2.19% maintenance of location
GO:0009057 2.19% macromolecule catabolic process
GO:0055081 2.19% anion homeostasis
GO:0051260 2.19% protein homooligomerization
GO:1903046 2.19% meiotic cell cycle process
GO:0098754 2.19% detoxification
GO:0002573 2.19% myeloid leukocyte differentiation
GO:0019731 2.19% antibacterial humoral response
GO:0051100 2.18% negative regulation of binding
GO:0019233 2.18% sensory perception of pain
GO:0045637 2.18% regulation of myeloid cell differentiation
GO:0051052 2.18% regulation of DNA metabolic process
GO:0048871 2.18% multicellular organismal homeostasis
GO:0042335 2.18% cuticle development
GO:0071398 2.18% cellular response to fatty acid
GO:0032890 2.18% regulation of organic acid transport
GO:0030282 2.18% bone mineralization
GO:0016485 2.18% protein processing
GO:0060078 2.18% regulation of postsynaptic membrane potential
GO:0043484 2.18% regulation of RNA splicing
GO:0017157 2.18% regulation of exocytosis
GO:0045089 2.17% positive regulation of innate immune response
GO:0060918 2.17% auxin transport
GO:0006518 2.17% peptide metabolic process
GO:1904064 2.17% positive regulation of cation transmembrane transport
GO:0010171 2.17% body morphogenesis
GO:0051186 2.17% cofactor metabolic process
GO:0050906 2.17% detection of stimulus involved in sensory perception
GO:0010769 2.17% regulation of cell morphogenesis involved in differentiation
GO:0051966 2.17% regulation of synaptic transmission, glutamatergic
GO:0043462 2.17% regulation of ATPase activity
GO:0010948 2.17% negative regulation of cell cycle process
GO:1902074 2.17% response to salt
GO:0007018 2.16% microtubule-based movement
GO:0007160 2.16% cell-matrix adhesion
GO:0045616 2.16% regulation of keratinocyte differentiation
GO:0043279 2.16% response to alkaloid
GO:0009150 2.16% purine ribonucleotide metabolic process
GO:1902903 2.16% regulation of supramolecular fiber organization
GO:0016458 2.15% gene silencing
GO:0050773 2.15% regulation of dendrite development
GO:0015918 2.15% sterol transport
GO:0001508 2.15% action potential
GO:0008361 2.15% regulation of cell size
GO:0045860 2.15% positive regulation of protein kinase activity
GO:0043627 2.15% response to estrogen
GO:0030031 2.15% cell projection assembly
GO:0009742 2.15% brassinosteroid mediated signaling pathway
GO:0006458 2.15% 'de novo' protein folding
GO:0017148 2.14% negative regulation of translation
GO:0030279 2.14% negative regulation of ossification
GO:0070201 2.14% regulation of establishment of protein localization
GO:0002832 2.14% negative regulation of response to biotic stimulus
GO:0050922 2.14% negative regulation of chemotaxis
GO:0006694 2.14% steroid biosynthetic process
GO:0006720 2.14% isoprenoid metabolic process
GO:0051223 2.14% regulation of protein transport
GO:0031670 2.14% cellular response to nutrient
GO:0006259 2.14% DNA metabolic process
GO:0032892 2.14% positive regulation of organic acid transport
GO:0031960 2.14% response to corticosteroid
GO:0043393 2.13% regulation of protein binding
GO:0033363 2.13% secretory granule organization
GO:0019953 2.13% sexual reproduction
GO:0034637 2.13% cellular carbohydrate biosynthetic process
GO:0006940 2.13% regulation of smooth muscle contraction
GO:0034249 2.13% negative regulation of cellular amide metabolic process
GO:0009629 2.13% response to gravity
GO:0000278 2.13% mitotic cell cycle
GO:0003018 2.13% vascular process in circulatory system
GO:0034694 2.13% response to prostaglandin
GO:0046885 2.13% regulation of hormone biosynthetic process
GO:0032956 2.12% regulation of actin cytoskeleton organization
GO:0032886 2.12% regulation of microtubule-based process
GO:0120035 2.12% regulation of plasma membrane bounded cell projection organization
GO:0010927 2.12% cellular component assembly involved in morphogenesis
GO:0099601 2.12% regulation of neurotransmitter receptor activity
GO:0048754 2.12% branching morphogenesis of an epithelial tube
GO:0022408 2.12% negative regulation of cell-cell adhesion
GO:0045471 2.12% response to ethanol
GO:1901419 2.12% regulation of response to alcohol
GO:0031098 2.12% stress-activated protein kinase signaling cascade
GO:0030856 2.12% regulation of epithelial cell differentiation
GO:0043523 2.12% regulation of neuron apoptotic process
GO:0007595 2.12% lactation
GO:0031646 2.11% positive regulation of nervous system process
GO:0042542 2.11% response to hydrogen peroxide
GO:1901657 2.11% glycosyl compound metabolic process
GO:0019934 2.11% cGMP-mediated signaling
GO:0043434 2.11% response to peptide hormone
GO:0006766 2.11% vitamin metabolic process
GO:0002700 2.11% regulation of production of molecular mediator of immune response
GO:0009988 2.10% cell-cell recognition
GO:0006281 2.10% DNA repair
GO:0050764 2.10% regulation of phagocytosis
GO:0048592 2.10% eye morphogenesis
GO:1903829 2.10% positive regulation of cellular protein localization
GO:0034767 2.10% positive regulation of ion transmembrane transport
GO:0006040 2.10% amino sugar metabolic process
GO:0060998 2.09% regulation of dendritic spine development
GO:0046683 2.09% response to organophosphorus
GO:0019439 2.09% aromatic compound catabolic process
GO:0035107 2.09% appendage morphogenesis
GO:0002521 2.09% leukocyte differentiation
GO:1901264 2.09% carbohydrate derivative transport
GO:0009751 2.09% response to salicylic acid
GO:0051881 2.09% regulation of mitochondrial membrane potential
GO:0042475 2.09% odontogenesis of dentin-containing tooth
GO:0048367 2.08% shoot system development
GO:0031100 2.08% animal organ regeneration
GO:0051957 2.08% positive regulation of amino acid transport
GO:0031330 2.08% negative regulation of cellular catabolic process
GO:0051495 2.08% positive regulation of cytoskeleton organization
GO:0009606 2.08% tropism
GO:2001257 2.08% regulation of cation channel activity
GO:0010224 2.08% response to UV-B
GO:0010923 2.08% negative regulation of phosphatase activity
GO:1903305 2.08% regulation of regulated secretory pathway
GO:0006576 2.08% cellular biogenic amine metabolic process
GO:0009738 2.08% abscisic acid-activated signaling pathway
GO:0040029 2.08% regulation of gene expression, epigenetic
GO:1903845 2.08% negative regulation of cellular response to transforming growth factor beta stimulus
GO:0031346 2.07% positive regulation of cell projection organization
GO:0030431 2.07% sleep
GO:0016999 2.07% antibiotic metabolic process
GO:0034097 2.07% response to cytokine
GO:0051216 2.07% cartilage development
GO:0043648 2.07% dicarboxylic acid metabolic process
GO:0046928 2.07% regulation of neurotransmitter secretion
GO:0002526 2.07% acute inflammatory response
GO:0044275 2.07% cellular carbohydrate catabolic process
GO:0010893 2.07% positive regulation of steroid biosynthetic process
GO:0047484 2.07% regulation of response to osmotic stress
GO:2001038 2.07% regulation of cellular response to drug
GO:0015979 2.06% photosynthesis
GO:0030512 2.06% negative regulation of transforming growth factor beta receptor signaling pathway
GO:0009063 2.06% cellular amino acid catabolic process
GO:0009584 2.06% detection of visible light
GO:0098869 2.06% cellular oxidant detoxification
GO:2001057 2.05% reactive nitrogen species metabolic process
GO:0042254 2.05% ribosome biogenesis
GO:0048284 2.05% organelle fusion
GO:0048827 2.05% phyllome development
GO:0045494 2.05% photoreceptor cell maintenance
GO:0050433 2.05% regulation of catecholamine secretion
GO:1901607 2.05% alpha-amino acid biosynthetic process
GO:1900140 2.04% regulation of seedling development
GO:1902932 2.04% positive regulation of alcohol biosynthetic process
GO:0006446 2.04% regulation of translational initiation
GO:0061138 2.04% morphogenesis of a branching epithelium
GO:0045940 2.04% positive regulation of steroid metabolic process
GO:0030099 2.04% myeloid cell differentiation
GO:0042572 2.04% retinol metabolic process
GO:0042135 2.04% neurotransmitter catabolic process
GO:0046688 2.04% response to copper ion
GO:0051702 2.04% interaction with symbiont
GO:0044106 2.04% cellular amine metabolic process
GO:0002237 2.04% response to molecule of bacterial origin
GO:0045055 2.03% regulated exocytosis
GO:2000027 2.03% regulation of animal organ morphogenesis
GO:0010029 2.03% regulation of seed germination
GO:0055088 2.03% lipid homeostasis
GO:0097588 2.03% archaeal or bacterial-type flagellum-dependent cell motility
GO:1905957 2.03% regulation of cellular response to alcohol
GO:0008210 2.03% estrogen metabolic process
GO:0031136 2.02% positive regulation of conjugation
GO:0030048 2.02% actin filament-based movement
GO:0002697 2.02% regulation of immune effector process
GO:0006163 2.02% purine nucleotide metabolic process
GO:0022900 2.02% electron transport chain
GO:0006941 2.02% striated muscle contraction
GO:0008016 2.02% regulation of heart contraction
GO:0048732 2.02% gland development
GO:0050777 2.02% negative regulation of immune response
GO:0032963 2.02% collagen metabolic process
GO:0008203 2.02% cholesterol metabolic process
GO:0033555 2.02% multicellular organismal response to stress
GO:0050729 2.02% positive regulation of inflammatory response
GO:0032872 2.02% regulation of stress-activated MAPK cascade
GO:0030587 2.01% sorocarp development
GO:1905475 2.01% regulation of protein localization to membrane
GO:0050684 2.01% regulation of mRNA processing
GO:0051085 2.01% chaperone cofactor-dependent protein refolding
GO:0043470 2.01% regulation of carbohydrate catabolic process
GO:0090567 2.01% reproductive shoot system development
GO:0009626 2.01% plant-type hypersensitive response
GO:0008543 2.01% fibroblast growth factor receptor signaling pathway
GO:0045685 2.01% regulation of glial cell differentiation
GO:0043409 2.00% negative regulation of MAPK cascade
GO:0001503 2.00% ossification
GO:0070168 2.00% negative regulation of biomineral tissue development
GO:1900424 2.00% regulation of defense response to bacterium
GO:0032496 2.00% response to lipopolysaccharide
GO:0031288 2.00% sorocarp morphogenesis
GO:0034330 2.00% cell junction organization
GO:0060326 2.00% cell chemotaxis
GO:1903706 2.00% regulation of hemopoiesis
GO:0051017 2.00% actin filament bundle assembly
GO:0034284 1.99% response to monosaccharide
GO:0042176 1.99% regulation of protein catabolic process
GO:0007178 1.99% transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0042538 1.99% hyperosmotic salinity response
GO:0045862 1.99% positive regulation of proteolysis
GO:0090702 1.99% non-reproductive fruiting body development
GO:0071941 1.99% nitrogen cycle metabolic process
GO:0051851 1.99% modification by host of symbiont morphology or physiology
GO:0006090 1.99% pyruvate metabolic process
GO:0042537 1.99% benzene-containing compound metabolic process
GO:0014706 1.99% striated muscle tissue development
GO:0110053 1.99% regulation of actin filament organization
GO:0061061 1.98% muscle structure development
GO:0051955 1.98% regulation of amino acid transport
GO:1905939 1.98% regulation of gonad development
GO:0046324 1.98% regulation of glucose import
GO:0060349 1.98% bone morphogenesis
GO:0120163 1.98% negative regulation of cold-induced thermogenesis
GO:0035150 1.98% regulation of tube size
GO:0071277 1.98% cellular response to calcium ion
GO:0035239 1.98% tube morphogenesis
GO:0009952 1.98% anterior/posterior pattern specification
GO:0010975 1.98% regulation of neuron projection development
GO:0031331 1.98% positive regulation of cellular catabolic process
GO:0120178 1.97% steroid hormone biosynthetic process
GO:1900120 1.97% regulation of receptor binding
GO:0034050 1.97% host programmed cell death induced by symbiont
GO:0048286 1.97% lung alveolus development
GO:0050805 1.97% negative regulation of synaptic transmission
GO:0072350 1.97% tricarboxylic acid metabolic process
GO:0000165 1.97% MAPK cascade
GO:0010884 1.97% positive regulation of lipid storage
GO:0046686 1.97% response to cadmium ion
GO:0018105 1.97% peptidyl-serine phosphorylation
GO:1901137 1.96% carbohydrate derivative biosynthetic process
GO:0045746 1.96% negative regulation of Notch signaling pathway
GO:0060966 1.96% regulation of gene silencing by RNA
GO:0010907 1.96% positive regulation of glucose metabolic process
GO:0032006 1.96% regulation of TOR signaling
GO:0048168 1.96% regulation of neuronal synaptic plasticity
GO:1905809 1.96% negative regulation of synapse organization
GO:2001233 1.96% regulation of apoptotic signaling pathway
GO:0010453 1.96% regulation of cell fate commitment
GO:0048521 1.96% negative regulation of behavior
GO:0001570 1.95% vasculogenesis
GO:0031139 1.95% positive regulation of conjugation with cellular fusion
GO:0043562 1.95% cellular response to nitrogen levels
GO:0044042 1.95% glucan metabolic process
GO:0015672 1.95% monovalent inorganic cation transport
GO:0018193 1.95% peptidyl-amino acid modification
GO:0006805 1.95% xenobiotic metabolic process
GO:0050728 1.95% negative regulation of inflammatory response
GO:0061013 1.95% regulation of mRNA catabolic process
GO:0007157 1.95% heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0044264 1.95% cellular polysaccharide metabolic process
GO:1902019 1.95% regulation of cilium-dependent cell motility
GO:0043949 1.95% regulation of cAMP-mediated signaling
GO:0045185 1.95% maintenance of protein location
GO:0006073 1.95% cellular glucan metabolic process
GO:0099174 1.95% regulation of presynapse organization
GO:0033500 1.95% carbohydrate homeostasis
GO:0009185 1.94% ribonucleoside diphosphate metabolic process
GO:0009908 1.94% flower development
GO:0097327 1.94% response to antineoplastic agent
GO:2000106 1.94% regulation of leukocyte apoptotic process
GO:0043200 1.94% response to amino acid
GO:0050673 1.94% epithelial cell proliferation
GO:0001942 1.94% hair follicle development
GO:0009451 1.94% RNA modification
GO:0032271 1.94% regulation of protein polymerization
GO:0046942 1.94% carboxylic acid transport
GO:0050808 1.94% synapse organization
GO:0032526 1.94% response to retinoic acid
GO:0070302 1.93% regulation of stress-activated protein kinase signaling cascade
GO:1990748 1.93% cellular detoxification
GO:0045944 1.93% positive regulation of transcription by RNA polymerase II
GO:0048806 1.93% genitalia development
GO:0042472 1.93% inner ear morphogenesis
GO:0007163 1.93% establishment or maintenance of cell polarity
GO:0009787 1.93% regulation of abscisic acid-activated signaling pathway
GO:0035112 1.93% genitalia morphogenesis
GO:0022413 1.93% reproductive process in single-celled organism
GO:0006081 1.93% cellular aldehyde metabolic process
GO:0014013 1.92% regulation of gliogenesis
GO:0000041 1.92% transition metal ion transport
GO:0055067 1.92% monovalent inorganic cation homeostasis
GO:0050830 1.92% defense response to Gram-positive bacterium
GO:0009753 1.92% response to jasmonic acid
GO:0005984 1.92% disaccharide metabolic process
GO:0019835 1.92% cytolysis
GO:0032922 1.92% circadian regulation of gene expression
GO:1901379 1.92% regulation of potassium ion transmembrane transport
GO:0098900 1.92% regulation of action potential
GO:0048660 1.92% regulation of smooth muscle cell proliferation
GO:0097756 1.92% negative regulation of blood vessel diameter
GO:0046165 1.92% alcohol biosynthetic process
GO:0045604 1.91% regulation of epidermal cell differentiation
GO:0010883 1.91% regulation of lipid storage
GO:0007219 1.91% Notch signaling pathway
GO:1905521 1.91% regulation of macrophage migration
GO:0070232 1.91% regulation of T cell apoptotic process
GO:0031641 1.91% regulation of myelination
GO:0015849 1.91% organic acid transport
GO:0043094 1.91% cellular metabolic compound salvage
GO:0033135 1.91% regulation of peptidyl-serine phosphorylation
GO:0042304 1.91% regulation of fatty acid biosynthetic process
GO:0090100 1.91% positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0070373 1.91% negative regulation of ERK1 and ERK2 cascade
GO:0023014 1.91% signal transduction by protein phosphorylation
GO:0043488 1.90% regulation of mRNA stability
GO:0070555 1.90% response to interleukin-1
GO:0042753 1.90% positive regulation of circadian rhythm
GO:0044270 1.90% cellular nitrogen compound catabolic process
GO:0002164 1.90% larval development
GO:0006521 1.90% regulation of cellular amino acid metabolic process
GO:0032413 1.90% negative regulation of ion transmembrane transporter activity
GO:0032386 1.90% regulation of intracellular transport
GO:0001889 1.90% liver development
GO:0006662 1.90% glycerol ether metabolic process
GO:0051896 1.89% regulation of protein kinase B signaling
GO:0071345 1.89% cellular response to cytokine stimulus
GO:0005979 1.89% regulation of glycogen biosynthetic process
GO:0060179 1.89% male mating behavior
GO:0009072 1.89% aromatic amino acid family metabolic process
GO:0035265 1.89% organ growth
GO:0042439 1.89% ethanolamine-containing compound metabolic process
GO:0045668 1.89% negative regulation of osteoblast differentiation
GO:0051384 1.89% response to glucocorticoid
GO:1900078 1.89% positive regulation of cellular response to insulin stimulus
GO:0051054 1.89% positive regulation of DNA metabolic process
GO:0010212 1.89% response to ionizing radiation
GO:0008593 1.89% regulation of Notch signaling pathway
GO:0050730 1.89% regulation of peptidyl-tyrosine phosphorylation
GO:0030832 1.89% regulation of actin filament length
GO:0043542 1.88% endothelial cell migration
GO:0007193 1.88% adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0009746 1.88% response to hexose
GO:0042402 1.88% cellular biogenic amine catabolic process
GO:0006821 1.88% chloride transport
GO:0030301 1.88% cholesterol transport
GO:2001222 1.88% regulation of neuron migration
GO:0009637 1.88% response to blue light
GO:0018904 1.88% ether metabolic process
GO:0006275 1.88% regulation of DNA replication
GO:0042593 1.88% glucose homeostasis
GO:0006413 1.87% translational initiation
GO:0071260 1.87% cellular response to mechanical stimulus
GO:0045428 1.87% regulation of nitric oxide biosynthetic process
GO:0009699 1.87% phenylpropanoid biosynthetic process
GO:0015718 1.87% monocarboxylic acid transport
GO:0006879 1.87% cellular iron ion homeostasis
GO:0051898 1.87% negative regulation of protein kinase B signaling
GO:0006817 1.87% phosphate ion transport
GO:0035036 1.86% sperm-egg recognition
GO:0048568 1.86% embryonic organ development
GO:0061515 1.86% myeloid cell development
GO:0034329 1.86% cell junction assembly
GO:2000179 1.86% positive regulation of neural precursor cell proliferation
GO:0035296 1.86% regulation of tube diameter
GO:0045666 1.86% positive regulation of neuron differentiation
GO:0018298 1.86% protein-chromophore linkage
GO:0030178 1.86% negative regulation of Wnt signaling pathway
GO:0046887 1.85% positive regulation of hormone secretion
GO:1904951 1.85% positive regulation of establishment of protein localization
GO:0006740 1.85% NADPH regeneration
GO:0061448 1.85% connective tissue development
GO:0007281 1.85% germ cell development
GO:0002366 1.85% leukocyte activation involved in immune response
GO:0006575 1.85% cellular modified amino acid metabolic process
GO:0030900 1.85% forebrain development
GO:0006399 1.85% tRNA metabolic process
GO:0071554 1.85% cell wall organization or biogenesis
GO:0032984 1.85% protein-containing complex disassembly
GO:0042044 1.85% fluid transport
GO:0030316 1.85% osteoclast differentiation
GO:0002263 1.84% cell activation involved in immune response
GO:0006767 1.84% water-soluble vitamin metabolic process
GO:0008156 1.84% negative regulation of DNA replication
GO:0043524 1.84% negative regulation of neuron apoptotic process
GO:0044265 1.84% cellular macromolecule catabolic process
GO:0034612 1.84% response to tumor necrosis factor
GO:0070098 1.84% chemokine-mediated signaling pathway
GO:1901160 1.84% primary amino compound metabolic process
GO:0032506 1.84% cytokinetic process
GO:0017001 1.84% antibiotic catabolic process
GO:0051222 1.83% positive regulation of protein transport
GO:0042310 1.83% vasoconstriction
GO:0003073 1.83% regulation of systemic arterial blood pressure
GO:0006813 1.83% potassium ion transport
GO:0097746 1.83% regulation of blood vessel diameter
GO:0048713 1.83% regulation of oligodendrocyte differentiation
GO:2001235 1.83% positive regulation of apoptotic signaling pathway
GO:0071356 1.83% cellular response to tumor necrosis factor
GO:0009749 1.83% response to glucose
GO:0009310 1.83% amine catabolic process
GO:0045229 1.83% external encapsulating structure organization
GO:0051053 1.83% negative regulation of DNA metabolic process
GO:0051092 1.83% positive regulation of NF-kappaB transcription factor activity
GO:0006111 1.83% regulation of gluconeogenesis
GO:0044085 1.83% cellular component biogenesis
GO:0035295 1.82% tube development
GO:0070228 1.82% regulation of lymphocyte apoptotic process
GO:0016125 1.82% sterol metabolic process
GO:0019321 1.82% pentose metabolic process
GO:1902882 1.82% regulation of response to oxidative stress
GO:0043392 1.82% negative regulation of DNA binding
GO:0006887 1.82% exocytosis
GO:0001822 1.82% kidney development
GO:2001021 1.82% negative regulation of response to DNA damage stimulus
GO:0009593 1.82% detection of chemical stimulus
GO:0030947 1.82% regulation of vascular endothelial growth factor receptor signaling pathway
GO:0048147 1.82% negative regulation of fibroblast proliferation
GO:0032411 1.82% positive regulation of transporter activity
GO:0006942 1.82% regulation of striated muscle contraction
GO:0070633 1.82% transepithelial transport
GO:0010811 1.82% positive regulation of cell-substrate adhesion
GO:0040034 1.81% regulation of development, heterochronic
GO:0050994 1.81% regulation of lipid catabolic process
GO:0044550 1.81% secondary metabolite biosynthetic process
GO:1901222 1.81% regulation of NIK/NF-kappaB signaling
GO:0048024 1.81% regulation of mRNA splicing, via spliceosome
GO:1903531 1.81% negative regulation of secretion by cell
GO:0051057 1.81% positive regulation of small GTPase mediated signal transduction
GO:2000378 1.80% negative regulation of reactive oxygen species metabolic process
GO:0055083 1.80% monovalent inorganic anion homeostasis
GO:0010001 1.80% glial cell differentiation
GO:0046777 1.80% protein autophosphorylation
GO:1900376 1.80% regulation of secondary metabolite biosynthetic process
GO:0060828 1.80% regulation of canonical Wnt signaling pathway
GO:0022602 1.80% ovulation cycle process
GO:0007051 1.80% spindle organization
GO:2001025 1.80% positive regulation of response to drug
GO:0035108 1.80% limb morphogenesis
GO:1905477 1.80% positive regulation of protein localization to membrane
GO:0048662 1.79% negative regulation of smooth muscle cell proliferation
GO:0051180 1.79% vitamin transport
GO:0044242 1.79% cellular lipid catabolic process
GO:0043457 1.79% regulation of cellular respiration
GO:0035113 1.79% embryonic appendage morphogenesis
GO:0034654 1.79% nucleobase-containing compound biosynthetic process
GO:0033157 1.79% regulation of intracellular protein transport
GO:0030865 1.79% cortical cytoskeleton organization
GO:0006140 1.79% regulation of nucleotide metabolic process
GO:1904396 1.79% regulation of neuromuscular junction development
GO:0045930 1.79% negative regulation of mitotic cell cycle
GO:0051783 1.79% regulation of nuclear division
GO:0071555 1.79% cell wall organization
GO:0051403 1.78% stress-activated MAPK cascade
GO:0001707 1.78% mesoderm formation
GO:0120031 1.78% plasma membrane bounded cell projection assembly
GO:1901136 1.78% carbohydrate derivative catabolic process
GO:0033574 1.78% response to testosterone
GO:0044058 1.78% regulation of digestive system process
GO:0032570 1.78% response to progesterone
GO:0008582 1.78% regulation of synaptic growth at neuromuscular junction
GO:0048366 1.78% leaf development
GO:0048512 1.78% circadian behavior
GO:0014065 1.78% phosphatidylinositol 3-kinase signaling
GO:0045682 1.78% regulation of epidermis development
GO:0008064 1.78% regulation of actin polymerization or depolymerization
GO:0006775 1.78% fat-soluble vitamin metabolic process
GO:0016050 1.78% vesicle organization
GO:0043473 1.78% pigmentation
GO:0006119 1.78% oxidative phosphorylation
GO:0006661 1.78% phosphatidylinositol biosynthetic process
GO:0031156 1.77% regulation of sorocarp development
GO:0007622 1.77% rhythmic behavior
GO:0002119 1.77% nematode larval development
GO:0098660 1.77% inorganic ion transmembrane transport
GO:0006739 1.77% NADP metabolic process
GO:0046888 1.77% negative regulation of hormone secretion
GO:0002791 1.77% regulation of peptide secretion
GO:0045766 1.77% positive regulation of angiogenesis
GO:0015931 1.77% nucleobase-containing compound transport
GO:0008585 1.77% female gonad development
GO:1900006 1.77% positive regulation of dendrite development
GO:0032026 1.77% response to magnesium ion
GO:0050858 1.77% negative regulation of antigen receptor-mediated signaling pathway
GO:0001773 1.77% myeloid dendritic cell activation
GO:0044782 1.77% cilium organization
GO:0000578 1.76% embryonic axis specification
GO:0045472 1.76% response to ether
GO:1900426 1.76% positive regulation of defense response to bacterium
GO:0042058 1.76% regulation of epidermal growth factor receptor signaling pathway
GO:2000116 1.76% regulation of cysteine-type endopeptidase activity
GO:0006732 1.76% coenzyme metabolic process
GO:0070301 1.76% cellular response to hydrogen peroxide
GO:0060999 1.76% positive regulation of dendritic spine development
GO:0030705 1.76% cytoskeleton-dependent intracellular transport
GO:0042743 1.76% hydrogen peroxide metabolic process
GO:2000177 1.76% regulation of neural precursor cell proliferation
GO:1900407 1.76% regulation of cellular response to oxidative stress
GO:0051188 1.76% cofactor biosynthetic process
GO:0046628 1.76% positive regulation of insulin receptor signaling pathway
GO:1901184 1.75% regulation of ERBB signaling pathway
GO:0009812 1.75% flavonoid metabolic process
GO:0031345 1.75% negative regulation of cell projection organization
GO:0050732 1.75% negative regulation of peptidyl-tyrosine phosphorylation
GO:0031102 1.75% neuron projection regeneration
GO:0046474 1.75% glycerophospholipid biosynthetic process
GO:0045216 1.75% cell-cell junction organization
GO:0051701 1.75% interaction with host
GO:0090181 1.75% regulation of cholesterol metabolic process
GO:0072659 1.75% protein localization to plasma membrane
GO:0034310 1.75% primary alcohol catabolic process
GO:0007254 1.74% JNK cascade
GO:0002793 1.74% positive regulation of peptide secretion
GO:0009630 1.74% gravitropism
GO:0010632 1.74% regulation of epithelial cell migration
GO:0120034 1.74% positive regulation of plasma membrane bounded cell projection assembly
GO:0032370 1.74% positive regulation of lipid transport
GO:0007088 1.74% regulation of mitotic nuclear division
GO:0002790 1.74% peptide secretion
GO:0034976 1.74% response to endoplasmic reticulum stress
GO:0071902 1.74% positive regulation of protein serine/threonine kinase activity
GO:0030326 1.74% embryonic limb morphogenesis
GO:0048146 1.74% positive regulation of fibroblast proliferation
GO:0008033 1.74% tRNA processing
GO:0021675 1.74% nerve development
GO:0022613 1.73% ribonucleoprotein complex biogenesis
GO:0007566 1.73% embryo implantation
GO:0051276 1.73% chromosome organization
GO:0006605 1.73% protein targeting
GO:0050708 1.73% regulation of protein secretion
GO:0098586 1.73% cellular response to virus
GO:0060147 1.73% regulation of posttranscriptional gene silencing
GO:0002437 1.73% inflammatory response to antigenic stimulus
GO:0033209 1.73% tumor necrosis factor-mediated signaling pathway
GO:0051131 1.73% chaperone-mediated protein complex assembly
GO:0051588 1.73% regulation of neurotransmitter transport
GO:0042178 1.73% xenobiotic catabolic process
GO:0006886 1.72% intracellular protein transport
GO:0050865 1.72% regulation of cell activation
GO:0032410 1.72% negative regulation of transporter activity
GO:0043267 1.72% negative regulation of potassium ion transport
GO:0071901 1.72% negative regulation of protein serine/threonine kinase activity
GO:0034660 1.72% ncRNA metabolic process
GO:0045995 1.72% regulation of embryonic development
GO:0031152 1.72% aggregation involved in sorocarp development
GO:0006995 1.72% cellular response to nitrogen starvation
GO:0045665 1.72% negative regulation of neuron differentiation
GO:0032515 1.72% negative regulation of phosphoprotein phosphatase activity
GO:0010506 1.72% regulation of autophagy
GO:0072329 1.72% monocarboxylic acid catabolic process
GO:0042181 1.71% ketone biosynthetic process
GO:0032868 1.71% response to insulin
GO:2000272 1.71% negative regulation of signaling receptor activity
GO:0030518 1.71% intracellular steroid hormone receptor signaling pathway
GO:0030010 1.71% establishment of cell polarity
GO:0061062 1.71% regulation of nematode larval development
GO:1904018 1.70% positive regulation of vasculature development
GO:0046717 1.70% acid secretion
GO:0006826 1.70% iron ion transport
GO:0046620 1.70% regulation of organ growth
GO:0010594 1.70% regulation of endothelial cell migration
GO:0042177 1.70% negative regulation of protein catabolic process
GO:0030808 1.70% regulation of nucleotide biosynthetic process
GO:0051148 1.70% negative regulation of muscle cell differentiation
GO:0045824 1.70% negative regulation of innate immune response
GO:0046621 1.70% negative regulation of organ growth
GO:0048634 1.70% regulation of muscle organ development
GO:0007179 1.70% transforming growth factor beta receptor signaling pathway
GO:1900180 1.70% regulation of protein localization to nucleus
GO:0034470 1.69% ncRNA processing
GO:0000746 1.69% conjugation
GO:0045732 1.69% positive regulation of protein catabolic process
GO:0033280 1.69% response to vitamin D
GO:0035335 1.69% peptidyl-tyrosine dephosphorylation
GO:0014059 1.69% regulation of dopamine secretion
GO:0009081 1.69% branched-chain amino acid metabolic process
GO:0007229 1.69% integrin-mediated signaling pathway
GO:0006790 1.69% sulfur compound metabolic process
GO:0002687 1.68% positive regulation of leukocyte migration
GO:1902369 1.68% negative regulation of RNA catabolic process
GO:0048532 1.68% anatomical structure arrangement
GO:0030168 1.68% platelet activation
GO:1905114 1.68% cell surface receptor signaling pathway involved in cell-cell signaling
GO:0055070 1.68% copper ion homeostasis
GO:0007339 1.68% binding of sperm to zona pellucida
GO:0009867 1.68% jasmonic acid mediated signaling pathway
GO:1903509 1.68% liposaccharide metabolic process
GO:0046700 1.68% heterocycle catabolic process
GO:0050927 1.67% positive regulation of positive chemotaxis
GO:0060135 1.67% maternal process involved in female pregnancy
GO:0061564 1.67% axon development
GO:0060964 1.67% regulation of gene silencing by miRNA
GO:1900077 1.67% negative regulation of cellular response to insulin stimulus
GO:0033044 1.67% regulation of chromosome organization
GO:0097009 1.67% energy homeostasis
GO:0046209 1.67% nitric oxide metabolic process
GO:0060491 1.67% regulation of cell projection assembly
GO:0045333 1.67% cellular respiration
GO:0097485 1.67% neuron projection guidance
GO:0071824 1.67% protein-DNA complex subunit organization
GO:0032414 1.67% positive regulation of ion transmembrane transporter activity
GO:0010951 1.67% negative regulation of endopeptidase activity
GO:1905606 1.67% regulation of presynapse assembly
GO:0090102 1.67% cochlea development
GO:0070848 1.67% response to growth factor
GO:0035306 1.67% positive regulation of dephosphorylation
GO:0002694 1.67% regulation of leukocyte activation
GO:0007288 1.67% sperm axoneme assembly
GO:1904705 1.66% regulation of vascular smooth muscle cell proliferation
GO:0016441 1.66% posttranscriptional gene silencing
GO:1905392 1.66% plant organ morphogenesis
GO:0045933 1.66% positive regulation of muscle contraction
GO:0140253 1.66% cell-cell fusion
GO:0007569 1.66% cell aging
GO:0030004 1.66% cellular monovalent inorganic cation homeostasis
GO:0022618 1.66% ribonucleoprotein complex assembly
GO:0042744 1.66% hydrogen peroxide catabolic process
GO:0030574 1.66% collagen catabolic process
GO:0071692 1.66% protein localization to extracellular region
GO:0030437 1.66% ascospore formation
GO:0030104 1.66% water homeostasis
GO:0072089 1.66% stem cell proliferation
GO:0048706 1.66% embryonic skeletal system development
GO:0046467 1.66% membrane lipid biosynthetic process
GO:0030163 1.66% protein catabolic process
GO:0043604 1.66% amide biosynthetic process
GO:0016071 1.66% mRNA metabolic process
GO:0009110 1.66% vitamin biosynthetic process
GO:0050796 1.65% regulation of insulin secretion
GO:0051972 1.65% regulation of telomerase activity
GO:0090276 1.65% regulation of peptide hormone secretion
GO:0060193 1.65% positive regulation of lipase activity
GO:0009073 1.65% aromatic amino acid family biosynthetic process
GO:0032091 1.65% negative regulation of protein binding
GO:0042596 1.65% fear response
GO:0050907 1.65% detection of chemical stimulus involved in sensory perception
GO:0010894 1.65% negative regulation of steroid biosynthetic process
GO:0051193 1.65% regulation of cofactor metabolic process
GO:0002209 1.64% behavioral defense response
GO:0097529 1.64% myeloid leukocyte migration
GO:0034219 1.64% carbohydrate transmembrane transport
GO:0006665 1.64% sphingolipid metabolic process
GO:0098655 1.64% cation transmembrane transport
GO:0045639 1.64% positive regulation of myeloid cell differentiation
GO:0032228 1.64% regulation of synaptic transmission, GABAergic
GO:0046434 1.64% organophosphate catabolic process
GO:0002253 1.64% activation of immune response
GO:0034260 1.64% negative regulation of GTPase activity
GO:0046173 1.64% polyol biosynthetic process
GO:0045932 1.64% negative regulation of muscle contraction
GO:0032954 1.64% regulation of cytokinetic process
GO:0007411 1.64% axon guidance
GO:0071826 1.64% ribonucleoprotein complex subunit organization
GO:0007517 1.63% muscle organ development
GO:0009698 1.63% phenylpropanoid metabolic process
GO:0010677 1.63% negative regulation of cellular carbohydrate metabolic process
GO:0006986 1.63% response to unfolded protein
GO:0045787 1.63% positive regulation of cell cycle
GO:0006400 1.63% tRNA modification
GO:0042771 1.63% intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0031163 1.63% metallo-sulfur cluster assembly
GO:0043903 1.63% regulation of symbiosis, encompassing mutualism through parasitism
GO:0043268 1.63% positive regulation of potassium ion transport
GO:0007565 1.63% female pregnancy
GO:0010470 1.63% regulation of gastrulation
GO:0001662 1.62% behavioral fear response
GO:0046579 1.62% positive regulation of Ras protein signal transduction
GO:0098693 1.62% regulation of synaptic vesicle cycle
GO:0060968 1.62% regulation of gene silencing
GO:1902105 1.62% regulation of leukocyte differentiation
GO:1902905 1.62% positive regulation of supramolecular fiber organization
GO:0044062 1.62% regulation of excretion
GO:0007156 1.62% homophilic cell adhesion via plasma membrane adhesion molecules
GO:0051965 1.62% positive regulation of synapse assembly
GO:0002761 1.62% regulation of myeloid leukocyte differentiation
GO:0051101 1.62% regulation of DNA binding
GO:0097028 1.62% dendritic cell differentiation
GO:0090207 1.62% regulation of triglyceride metabolic process
GO:0002702 1.62% positive regulation of production of molecular mediator of immune response
GO:0051249 1.62% regulation of lymphocyte activation
GO:0033365 1.62% protein localization to organelle
GO:0035592 1.61% establishment of protein localization to extracellular region
GO:0009404 1.61% toxin metabolic process
GO:1904029 1.61% regulation of cyclin-dependent protein kinase activity
GO:0051169 1.61% nuclear transport
GO:1901568 1.61% fatty acid derivative metabolic process
GO:0010039 1.61% response to iron ion
GO:0009060 1.61% aerobic respiration
GO:0032768 1.61% regulation of monooxygenase activity
GO:0016055 1.61% Wnt signaling pathway
GO:0046649 1.61% lymphocyte activation
GO:0061687 1.61% detoxification of inorganic compound
GO:0030833 1.61% regulation of actin filament polymerization
GO:0048639 1.60% positive regulation of developmental growth
GO:0006913 1.60% nucleocytoplasmic transport
GO:0048704 1.60% embryonic skeletal system morphogenesis
GO:0009850 1.60% auxin metabolic process
GO:0001568 1.60% blood vessel development
GO:0032677 1.60% regulation of interleukin-8 production
GO:0042749 1.60% regulation of circadian sleep/wake cycle
GO:0033108 1.60% mitochondrial respiratory chain complex assembly
GO:0032781 1.60% positive regulation of ATPase activity
GO:0098656 1.60% anion transmembrane transport
GO:1990138 1.60% neuron projection extension
GO:0050900 1.60% leukocyte migration
GO:0035148 1.60% tube formation
GO:0006007 1.60% glucose catabolic process
GO:0007338 1.60% single fertilization
GO:0001938 1.60% positive regulation of endothelial cell proliferation
GO:0006664 1.60% glycolipid metabolic process
GO:0097191 1.60% extrinsic apoptotic signaling pathway
GO:1903010 1.60% regulation of bone development
GO:0090311 1.60% regulation of protein deacetylation
GO:1901655 1.60% cellular response to ketone
GO:0043433 1.60% negative regulation of DNA-binding transcription factor activity
GO:0071216 1.60% cellular response to biotic stimulus
GO:0044030 1.60% regulation of DNA methylation
GO:0016226 1.60% iron-sulfur cluster assembly
GO:0009108 1.59% coenzyme biosynthetic process
GO:1903670 1.59% regulation of sprouting angiogenesis
GO:0032365 1.59% intracellular lipid transport
GO:0010228 1.59% vegetative to reproductive phase transition of meristem
GO:0050714 1.59% positive regulation of protein secretion
GO:0043647 1.59% inositol phosphate metabolic process
GO:0030968 1.59% endoplasmic reticulum unfolded protein response
GO:0010634 1.59% positive regulation of epithelial cell migration
GO:0051883 1.59% killing of cells in other organism involved in symbiotic interaction
GO:0050912 1.59% detection of chemical stimulus involved in sensory perception of taste
GO:0051818 1.59% disruption of cells of other organism involved in symbiotic interaction
GO:0008380 1.59% RNA splicing
GO:0009082 1.59% branched-chain amino acid biosynthetic process
GO:0010226 1.59% response to lithium ion
GO:0016339 1.59% calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0090277 1.58% positive regulation of peptide hormone secretion
GO:0043405 1.58% regulation of MAP kinase activity
GO:0046627 1.58% negative regulation of insulin receptor signaling pathway
GO:0072332 1.58% intrinsic apoptotic signaling pathway by p53 class mediator
GO:0032652 1.58% regulation of interleukin-1 production
GO:0042246 1.58% tissue regeneration
GO:0046328 1.58% regulation of JNK cascade
GO:0045987 1.58% positive regulation of smooth muscle contraction
GO:0010712 1.58% regulation of collagen metabolic process
GO:0033138 1.58% positive regulation of peptidyl-serine phosphorylation
GO:1903320 1.58% regulation of protein modification by small protein conjugation or removal
GO:0071867 1.58% response to monoamine
GO:0051928 1.58% positive regulation of calcium ion transport
GO:0034655 1.58% nucleobase-containing compound catabolic process
GO:0006012 1.58% galactose metabolic process
GO:0000272 1.58% polysaccharide catabolic process
GO:0007286 1.57% spermatid development
GO:0060191 1.57% regulation of lipase activity
GO:0042303 1.57% molting cycle
GO:0040018 1.57% positive regulation of multicellular organism growth
GO:1904375 1.57% regulation of protein localization to cell periphery
GO:0060271 1.57% cilium assembly
GO:0042659 1.57% regulation of cell fate specification
GO:0009306 1.57% protein secretion
GO:0007616 1.57% long-term memory
GO:0046850 1.57% regulation of bone remodeling
GO:1902850 1.57% microtubule cytoskeleton organization involved in mitosis
GO:0110151 1.57% positive regulation of biomineralization
GO:0001654 1.57% eye development
GO:0050866 1.57% negative regulation of cell activation
GO:0051852 1.57% disruption by host of symbiont cells
GO:0046626 1.57% regulation of insulin receptor signaling pathway
GO:0061351 1.57% neural precursor cell proliferation
GO:0035194 1.56% posttranscriptional gene silencing by RNA
GO:0051099 1.56% positive regulation of binding
GO:0009112 1.56% nucleobase metabolic process
GO:1903321 1.56% negative regulation of protein modification by small protein conjugation or removal
GO:0009712 1.56% catechol-containing compound metabolic process
GO:0030091 1.56% protein repair
GO:0007530 1.56% sex determination
GO:0090693 1.56% plant organ senescence
GO:0043153 1.56% entrainment of circadian clock by photoperiod
GO:0002718 1.56% regulation of cytokine production involved in immune response
GO:0045017 1.56% glycerolipid biosynthetic process
GO:0009135 1.56% purine nucleoside diphosphate metabolic process
GO:0032273 1.56% positive regulation of protein polymerization
GO:1903035 1.56% negative regulation of response to wounding
GO:0046470 1.56% phosphatidylcholine metabolic process
GO:0010922 1.56% positive regulation of phosphatase activity
GO:1903708 1.56% positive regulation of hemopoiesis
GO:1902883 1.56% negative regulation of response to oxidative stress
GO:0048285 1.55% organelle fission
GO:0030595 1.55% leukocyte chemotaxis
GO:0051897 1.55% positive regulation of protein kinase B signaling
GO:0045939 1.55% negative regulation of steroid metabolic process
GO:0009066 1.55% aspartate family amino acid metabolic process
GO:0051147 1.55% regulation of muscle cell differentiation
GO:0007043 1.55% cell-cell junction assembly
GO:2000249 1.55% regulation of actin cytoskeleton reorganization
GO:0050849 1.55% negative regulation of calcium-mediated signaling
GO:1901570 1.55% fatty acid derivative biosynthetic process
GO:0051225 1.55% spindle assembly
GO:0050863 1.55% regulation of T cell activation
GO:0010812 1.55% negative regulation of cell-substrate adhesion
GO:0032098 1.55% regulation of appetite
GO:0019757 1.55% glycosinolate metabolic process
GO:0002690 1.55% positive regulation of leukocyte chemotaxis
GO:0010150 1.55% leaf senescence
GO:0060148 1.55% positive regulation of posttranscriptional gene silencing
GO:0050856 1.54% regulation of T cell receptor signaling pathway
GO:0042755 1.54% eating behavior
GO:0006814 1.54% sodium ion transport
GO:0048666 1.54% neuron development
GO:1903428 1.54% positive regulation of reactive oxygen species biosynthetic process
GO:0042551 1.54% neuron maturation
GO:1901016 1.54% regulation of potassium ion transmembrane transporter activity
GO:0070838 1.54% divalent metal ion transport
GO:0010467 1.54% gene expression
GO:0043935 1.54% sexual sporulation resulting in formation of a cellular spore
GO:0045839 1.54% negative regulation of mitotic nuclear division
GO:0019430 1.54% removal of superoxide radicals
GO:0061035 1.54% regulation of cartilage development
GO:0022904 1.54% respiratory electron transport chain
GO:0007519 1.54% skeletal muscle tissue development
GO:0046189 1.54% phenol-containing compound biosynthetic process
GO:1903169 1.54% regulation of calcium ion transmembrane transport
GO:0018205 1.54% peptidyl-lysine modification
GO:0071870 1.54% cellular response to catecholamine stimulus
GO:0046822 1.54% regulation of nucleocytoplasmic transport
GO:2000278 1.54% regulation of DNA biosynthetic process
GO:0044770 1.53% cell cycle phase transition
GO:0045776 1.53% negative regulation of blood pressure
GO:0042306 1.53% regulation of protein import into nucleus
GO:0002229 1.53% defense response to oomycetes
GO:0002065 1.53% columnar/cuboidal epithelial cell differentiation
GO:0051784 1.53% negative regulation of nuclear division
GO:0019760 1.53% glucosinolate metabolic process
GO:2000637 1.53% positive regulation of gene silencing by miRNA
GO:0032388 1.53% positive regulation of intracellular transport
GO:0051603 1.53% proteolysis involved in cellular protein catabolic process
GO:0045745 1.53% positive regulation of G protein-coupled receptor signaling pathway
GO:0071684 1.53% organism emergence from protective structure
GO:2000300 1.53% regulation of synaptic vesicle exocytosis
GO:0031103 1.53% axon regeneration
GO:0008299 1.52% isoprenoid biosynthetic process
GO:0009068 1.52% aspartate family amino acid catabolic process
GO:2000401 1.52% regulation of lymphocyte migration
GO:0050926 1.52% regulation of positive chemotaxis
GO:1901653 1.52% cellular response to peptide
GO:0001764 1.52% neuron migration
GO:0071559 1.52% response to transforming growth factor beta
GO:0048026 1.52% positive regulation of mRNA splicing, via spliceosome
GO:0006641 1.52% triglyceride metabolic process
GO:0098662 1.52% inorganic cation transmembrane transport
GO:1900542 1.52% regulation of purine nucleotide metabolic process
GO:0046320 1.52% regulation of fatty acid oxidation
GO:0019915 1.51% lipid storage
GO:0008637 1.51% apoptotic mitochondrial changes
GO:0034766 1.51% negative regulation of ion transmembrane transport
GO:0034728 1.51% nucleosome organization
GO:0042545 1.51% cell wall modification
GO:0050657 1.51% nucleic acid transport
GO:0071869 1.51% response to catecholamine
GO:0043043 1.51% peptide biosynthetic process
GO:0051926 1.51% negative regulation of calcium ion transport
GO:0021953 1.51% central nervous system neuron differentiation
GO:0090322 1.51% regulation of superoxide metabolic process
GO:0009179 1.51% purine ribonucleoside diphosphate metabolic process
GO:0032418 1.51% lysosome localization
GO:0030838 1.50% positive regulation of actin filament polymerization
GO:0072331 1.50% signal transduction by p53 class mediator
GO:0007098 1.50% centrosome cycle
GO:0001580 1.50% detection of chemical stimulus involved in sensory perception of bitter taste
GO:0009071 1.50% serine family amino acid catabolic process
GO:0060612 1.50% adipose tissue development
GO:1902742 1.50% apoptotic process involved in development
GO:0099003 1.50% vesicle-mediated transport in synapse
GO:0032874 1.50% positive regulation of stress-activated MAPK cascade
GO:0043327 1.50% chemotaxis to cAMP
GO:0006690 1.50% icosanoid metabolic process
GO:0051453 1.50% regulation of intracellular pH
GO:0015908 1.50% fatty acid transport
GO:0051873 1.50% killing by host of symbiont cells
GO:0001959 1.50% regulation of cytokine-mediated signaling pathway
GO:0034293 1.50% sexual sporulation
GO:0043278 1.50% response to morphine
GO:0000387 1.50% spliceosomal snRNP assembly
GO:0007052 1.50% mitotic spindle organization
GO:2001242 1.50% regulation of intrinsic apoptotic signaling pathway
GO:1904063 1.50% negative regulation of cation transmembrane transport
GO:1903034 1.50% regulation of response to wounding
GO:0070169 1.50% positive regulation of biomineral tissue development
GO:0043242 1.49% negative regulation of protein complex disassembly
GO:0048813 1.49% dendrite morphogenesis
GO:0015749 1.49% monosaccharide transmembrane transport
GO:0045793 1.49% positive regulation of cell size
GO:0048736 1.49% appendage development
GO:0021955 1.49% central nervous system neuron axonogenesis
GO:0072175 1.49% epithelial tube formation
GO:0002239 1.49% response to oomycetes
GO:0031023 1.49% microtubule organizing center organization
GO:0016114 1.49% terpenoid biosynthetic process
GO:0071347 1.49% cellular response to interleukin-1
GO:0051607 1.49% defense response to virus
GO:1902904 1.49% negative regulation of supramolecular fiber organization
GO:0030100 1.49% regulation of endocytosis
GO:0048565 1.48% digestive tract development
GO:1905393 1.48% plant organ formation
GO:0042430 1.48% indole-containing compound metabolic process
GO:0072511 1.48% divalent inorganic cation transport
GO:1903338 1.48% regulation of cell wall organization or biogenesis
GO:0006582 1.48% melanin metabolic process
GO:1903578 1.48% regulation of ATP metabolic process
GO:0046855 1.48% inositol phosphate dephosphorylation
GO:0099111 1.48% microtubule-based transport
GO:0006302 1.48% double-strand break repair
GO:0060485 1.48% mesenchyme development
GO:0070252 1.48% actin-mediated cell contraction
GO:0071634 1.48% regulation of transforming growth factor beta production
GO:0045187 1.48% regulation of circadian sleep/wake cycle, sleep
GO:0010976 1.48% positive regulation of neuron projection development
GO:0009624 1.48% response to nematode
GO:0106070 1.48% regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0006801 1.48% superoxide metabolic process
GO:0061097 1.48% regulation of protein tyrosine kinase activity
GO:1901216 1.48% positive regulation of neuron death
GO:0006584 1.48% catecholamine metabolic process
GO:2001251 1.47% negative regulation of chromosome organization
GO:0090068 1.47% positive regulation of cell cycle process
GO:0030002 1.47% cellular anion homeostasis
GO:0045670 1.47% regulation of osteoclast differentiation
GO:0090150 1.47% establishment of protein localization to membrane
GO:0045744 1.47% negative regulation of G protein-coupled receptor signaling pathway
GO:0009132 1.47% nucleoside diphosphate metabolic process
GO:0071219 1.47% cellular response to molecule of bacterial origin
GO:0002064 1.47% epithelial cell development
GO:0046326 1.47% positive regulation of glucose import
GO:0031648 1.47% protein destabilization
GO:0071868 1.47% cellular response to monoamine stimulus
GO:0010828 1.47% positive regulation of glucose transmembrane transport
GO:0015893 1.47% drug transport
GO:1901381 1.47% positive regulation of potassium ion transmembrane transport
GO:0016241 1.47% regulation of macroautophagy
GO:0016143 1.47% S-glycoside metabolic process
GO:0018108 1.47% peptidyl-tyrosine phosphorylation
GO:0033120 1.47% positive regulation of RNA splicing
GO:0009116 1.47% nucleoside metabolic process
GO:0000917 1.47% division septum assembly
GO:0044772 1.47% mitotic cell cycle phase transition
GO:1903317 1.46% regulation of protein maturation
GO:0016202 1.46% regulation of striated muscle tissue development
GO:0030641 1.46% regulation of cellular pH
GO:0021545 1.46% cranial nerve development
GO:0022612 1.46% gland morphogenesis
GO:0035966 1.46% response to topologically incorrect protein
GO:0018107 1.46% peptidyl-threonine phosphorylation
GO:0046031 1.46% ADP metabolic process
GO:0006706 1.46% steroid catabolic process
GO:0050848 1.46% regulation of calcium-mediated signaling
GO:0060759 1.46% regulation of response to cytokine stimulus
GO:0048229 1.46% gametophyte development
GO:0008209 1.46% androgen metabolic process
GO:0090279 1.46% regulation of calcium ion import
GO:0040036 1.46% regulation of fibroblast growth factor receptor signaling pathway
GO:0006165 1.45% nucleoside diphosphate phosphorylation
GO:0045980 1.45% negative regulation of nucleotide metabolic process
GO:0009064 1.45% glutamine family amino acid metabolic process
GO:0042692 1.45% muscle cell differentiation
GO:0090316 1.45% positive regulation of intracellular protein transport
GO:0051236 1.45% establishment of RNA localization
GO:0016570 1.45% histone modification
GO:0001835 1.45% blastocyst hatching
GO:0032965 1.45% regulation of collagen biosynthetic process
GO:0007422 1.45% peripheral nervous system development
GO:0002699 1.45% positive regulation of immune effector process
GO:0008625 1.45% extrinsic apoptotic signaling pathway via death domain receptors
GO:0048569 1.45% post-embryonic animal organ development
GO:1902275 1.45% regulation of chromatin organization
GO:2001259 1.45% positive regulation of cation channel activity
GO:0001704 1.44% formation of primary germ layer
GO:0043248 1.44% proteasome assembly
GO:0006885 1.44% regulation of pH
GO:0007349 1.44% cellularization
GO:0000271 1.44% polysaccharide biosynthetic process
GO:1901293 1.44% nucleoside phosphate biosynthetic process
GO:0006692 1.44% prostanoid metabolic process
GO:0010970 1.44% transport along microtubule
GO:1901623 1.44% regulation of lymphocyte chemotaxis
GO:0000280 1.44% nuclear division
GO:1990266 1.44% neutrophil migration
GO:0002218 1.44% activation of innate immune response
GO:0006323 1.44% DNA packaging
GO:0006816 1.44% calcium ion transport
GO:0043113 1.44% receptor clustering
GO:1903828 1.44% negative regulation of cellular protein localization
GO:0055008 1.44% cardiac muscle tissue morphogenesis
GO:0032147 1.44% activation of protein kinase activity
GO:0050658 1.44% RNA transport
GO:0071222 1.44% cellular response to lipopolysaccharide
GO:0010803 1.44% regulation of tumor necrosis factor-mediated signaling pathway
GO:0003254 1.44% regulation of membrane depolarization
GO:0071709 1.44% membrane assembly
GO:0090529 1.43% cell septum assembly
GO:0045214 1.43% sarcomere organization
GO:0010393 1.43% galacturonan metabolic process
GO:0060021 1.43% roof of mouth development
GO:1901343 1.43% negative regulation of vasculature development
GO:0006071 1.43% glycerol metabolic process
GO:0043281 1.43% regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043951 1.43% negative regulation of cAMP-mediated signaling
GO:0070304 1.43% positive regulation of stress-activated protein kinase signaling cascade
GO:0009069 1.43% serine family amino acid metabolic process
GO:1990928 1.43% response to amino acid starvation
GO:0036296 1.43% response to increased oxygen levels
GO:0051494 1.43% negative regulation of cytoskeleton organization
GO:1900371 1.43% regulation of purine nucleotide biosynthetic process
GO:0006878 1.43% cellular copper ion homeostasis
GO:0042440 1.43% pigment metabolic process
GO:0006730 1.43% one-carbon metabolic process
GO:0000038 1.42% very long-chain fatty acid metabolic process
GO:1903201 1.42% regulation of oxidative stress-induced cell death
GO:0060761 1.42% negative regulation of response to cytokine stimulus
GO:0003009 1.42% skeletal muscle contraction
GO:0006693 1.42% prostaglandin metabolic process
GO:0048839 1.42% inner ear development
GO:0033143 1.42% regulation of intracellular steroid hormone receptor signaling pathway
GO:0015721 1.42% bile acid and bile salt transport
GO:0046390 1.42% ribose phosphate biosynthetic process
GO:1904893 1.42% negative regulation of receptor signaling pathway via STAT
GO:1904377 1.42% positive regulation of protein localization to cell periphery
GO:0045669 1.42% positive regulation of osteoblast differentiation
GO:0051282 1.42% regulation of sequestering of calcium ion
GO:0051187 1.42% cofactor catabolic process
GO:0048008 1.42% platelet-derived growth factor receptor signaling pathway
GO:1903798 1.42% regulation of production of miRNAs involved in gene silencing by miRNA
GO:0048814 1.42% regulation of dendrite morphogenesis
GO:1901071 1.42% glucosamine-containing compound metabolic process
GO:0007549 1.42% dosage compensation
GO:0009845 1.42% seed germination
GO:0042573 1.42% retinoic acid metabolic process
GO:0002695 1.42% negative regulation of leukocyte activation
GO:0045778 1.42% positive regulation of ossification
GO:0051782 1.42% negative regulation of cell division
GO:0033875 1.42% ribonucleoside bisphosphate metabolic process
GO:1901019 1.42% regulation of calcium ion transmembrane transporter activity
GO:0014910 1.42% regulation of smooth muscle cell migration
GO:0042435 1.42% indole-containing compound biosynthetic process
GO:0050891 1.42% multicellular organismal water homeostasis
GO:0060048 1.41% cardiac muscle contraction
GO:0009187 1.41% cyclic nucleotide metabolic process
GO:0051973 1.41% positive regulation of telomerase activity
GO:0097366 1.41% response to bronchodilator
GO:0042069 1.41% regulation of catecholamine metabolic process
GO:0014072 1.41% response to isoquinoline alkaloid
GO:0061045 1.41% negative regulation of wound healing
GO:0006397 1.41% mRNA processing
GO:0001709 1.41% cell fate determination
GO:0032660 1.41% regulation of interleukin-17 production
GO:1903524 1.41% positive regulation of blood circulation
GO:0048563 1.41% post-embryonic animal organ morphogenesis
GO:0022409 1.41% positive regulation of cell-cell adhesion
GO:0010119 1.41% regulation of stomatal movement
GO:0001960 1.41% negative regulation of cytokine-mediated signaling pathway
GO:0048873 1.41% homeostasis of number of cells within a tissue
GO:0016925 1.41% protein sumoylation
GO:0010524 1.41% positive regulation of calcium ion transport into cytosol
GO:1900744 1.41% regulation of p38MAPK cascade
GO:0042026 1.40% protein refolding
GO:0032352 1.40% positive regulation of hormone metabolic process
GO:0032008 1.40% positive regulation of TOR signaling
GO:0030510 1.40% regulation of BMP signaling pathway
GO:0070417 1.40% cellular response to cold
GO:0090090 1.40% negative regulation of canonical Wnt signaling pathway
GO:0043954 1.40% cellular component maintenance
GO:0043551 1.40% regulation of phosphatidylinositol 3-kinase activity
GO:1900181 1.40% negative regulation of protein localization to nucleus
GO:0060840 1.40% artery development
GO:2001258 1.40% negative regulation of cation channel activity
GO:0006004 1.40% fucose metabolic process
GO:0016569 1.40% covalent chromatin modification
GO:0033559 1.40% unsaturated fatty acid metabolic process
GO:0038179 1.40% neurotrophin signaling pathway
GO:0030072 1.40% peptide hormone secretion
GO:1905897 1.40% regulation of response to endoplasmic reticulum stress
GO:0014911 1.40% positive regulation of smooth muscle cell migration
GO:0060688 1.40% regulation of morphogenesis of a branching structure
GO:0072524 1.39% pyridine-containing compound metabolic process
GO:1903409 1.39% reactive oxygen species biosynthetic process
GO:0006865 1.39% amino acid transport
GO:0045488 1.39% pectin metabolic process
GO:0032651 1.39% regulation of interleukin-1 beta production
GO:0061919 1.39% process utilizing autophagic mechanism
GO:0098815 1.39% modulation of excitatory postsynaptic potential
GO:0000079 1.39% regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0071715 1.39% icosanoid transport
GO:0048641 1.39% regulation of skeletal muscle tissue development
GO:0002027 1.39% regulation of heart rate
GO:0001676 1.39% long-chain fatty acid metabolic process
GO:2000181 1.39% negative regulation of blood vessel morphogenesis
GO:0046838 1.39% phosphorylated carbohydrate dephosphorylation
GO:1901658 1.39% glycosyl compound catabolic process
GO:0050819 1.39% negative regulation of coagulation
GO:0001944 1.39% vasculature development
GO:0050996 1.39% positive regulation of lipid catabolic process
GO:1903078 1.39% positive regulation of protein localization to plasma membrane
GO:0009657 1.39% plastid organization
GO:0010522 1.39% regulation of calcium ion transport into cytosol
GO:0019405 1.38% alditol catabolic process
GO:0021537 1.38% telencephalon development
GO:0071320 1.38% cellular response to cAMP
GO:0046685 1.38% response to arsenic-containing substance
GO:0007528 1.38% neuromuscular junction development
GO:1904589 1.38% regulation of protein import
GO:2000403 1.38% positive regulation of lymphocyte migration
GO:0033865 1.38% nucleoside bisphosphate metabolic process
GO:0042126 1.38% nitrate metabolic process
GO:0014048 1.38% regulation of glutamate secretion
GO:0009950 1.38% dorsal/ventral axis specification
GO:2000008 1.38% regulation of protein localization to cell surface
GO:0002088 1.38% lens development in camera-type eye
GO:0071675 1.38% regulation of mononuclear cell migration
GO:0090025 1.38% regulation of monocyte chemotaxis
GO:0035188 1.38% hatching
GO:0061037 1.38% negative regulation of cartilage development
GO:1901739 1.38% regulation of myoblast fusion
GO:0010518 1.38% positive regulation of phospholipase activity
GO:0009165 1.38% nucleotide biosynthetic process
GO:1901031 1.37% regulation of response to reactive oxygen species
GO:0006566 1.37% threonine metabolic process
GO:0046839 1.37% phospholipid dephosphorylation
GO:0060415 1.37% muscle tissue morphogenesis
GO:0060142 1.37% regulation of syncytium formation by plasma membrane fusion
GO:0071363 1.37% cellular response to growth factor stimulus
GO:0007292 1.37% female gamete generation
GO:0060456 1.37% positive regulation of digestive system process
GO:1901987 1.37% regulation of cell cycle phase transition
GO:0050931 1.37% pigment cell differentiation
GO:0003279 1.37% cardiac septum development
GO:0070663 1.37% regulation of leukocyte proliferation
GO:0010288 1.37% response to lead ion
GO:0018212 1.37% peptidyl-tyrosine modification
GO:0005977 1.37% glycogen metabolic process
GO:0006914 1.36% autophagy
GO:0090598 1.36% male anatomical structure morphogenesis
GO:2001024 1.36% negative regulation of response to drug
GO:0030177 1.36% positive regulation of Wnt signaling pathway
GO:0051491 1.36% positive regulation of filopodium assembly
GO:0050918 1.36% positive chemotaxis
GO:0051261 1.36% protein depolymerization
GO:0046939 1.36% nucleotide phosphorylation
GO:0071669 1.36% plant-type cell wall organization or biogenesis
GO:1903036 1.36% positive regulation of response to wounding
GO:0010758 1.36% regulation of macrophage chemotaxis
GO:0034103 1.36% regulation of tissue remodeling
GO:0007585 1.36% respiratory gaseous exchange by respiratory system
GO:0043010 1.36% camera-type eye development
GO:0032928 1.36% regulation of superoxide anion generation
GO:0003382 1.36% epithelial cell morphogenesis
GO:0050995 1.36% negative regulation of lipid catabolic process
GO:0061025 1.36% membrane fusion
GO:0042481 1.36% regulation of odontogenesis
GO:0090342 1.36% regulation of cell aging
GO:0032680 1.36% regulation of tumor necrosis factor production
GO:0006103 1.36% 2-oxoglutarate metabolic process
GO:0051650 1.36% establishment of vesicle localization
GO:0030858 1.36% positive regulation of epithelial cell differentiation
GO:0071466 1.36% cellular response to xenobiotic stimulus
GO:0070050 1.36% neuron cellular homeostasis
GO:0042761 1.36% very long-chain fatty acid biosynthetic process
GO:0045921 1.36% positive regulation of exocytosis
GO:1902667 1.36% regulation of axon guidance
GO:1903202 1.36% negative regulation of oxidative stress-induced cell death
GO:0097428 1.35% protein maturation by iron-sulfur cluster transfer
GO:0071805 1.35% potassium ion transmembrane transport
GO:0045599 1.35% negative regulation of fat cell differentiation
GO:0070830 1.35% bicellular tight junction assembly
GO:0042113 1.35% B cell activation
GO:0030261 1.35% chromosome condensation
GO:0042136 1.35% neurotransmitter biosynthetic process
GO:0071548 1.35% response to dexamethasone
GO:0035307 1.35% positive regulation of protein dephosphorylation
GO:0010977 1.35% negative regulation of neuron projection development
GO:0034311 1.35% diol metabolic process
GO:0042698 1.35% ovulation cycle
GO:0034032 1.35% purine nucleoside bisphosphate metabolic process
GO:1903432 1.35% regulation of TORC1 signaling
GO:0032720 1.35% negative regulation of tumor necrosis factor production
GO:1900449 1.35% regulation of glutamate receptor signaling pathway
GO:0090329 1.35% regulation of DNA-dependent DNA replication
GO:0055093 1.35% response to hyperoxia
GO:1902692 1.35% regulation of neuroblast proliferation
GO:0006089 1.35% lactate metabolic process
GO:1903580 1.35% positive regulation of ATP metabolic process
GO:0002698 1.35% negative regulation of immune effector process
GO:1903312 1.35% negative regulation of mRNA metabolic process
GO:1901571 1.35% fatty acid derivative transport
GO:0060079 1.35% excitatory postsynaptic potential
GO:0001936 1.35% regulation of endothelial cell proliferation
GO:0060122 1.35% inner ear receptor cell stereocilium organization
GO:0046697 1.34% decidualization
GO:0099173 1.34% postsynapse organization
GO:0035082 1.34% axoneme assembly
GO:1902749 1.34% regulation of cell cycle G2/M phase transition
GO:0060306 1.34% regulation of membrane repolarization
GO:0034446 1.34% substrate adhesion-dependent cell spreading
GO:0072091 1.34% regulation of stem cell proliferation
GO:0002285 1.34% lymphocyte activation involved in immune response
GO:0045843 1.34% negative regulation of striated muscle tissue development
GO:0033627 1.34% cell adhesion mediated by integrin
GO:2000826 1.34% regulation of heart morphogenesis
GO:0031342 1.34% negative regulation of cell killing
GO:2001234 1.34% negative regulation of apoptotic signaling pathway
GO:0048477 1.34% oogenesis
GO:0003281 1.34% ventricular septum development
GO:0030866 1.34% cortical actin cytoskeleton organization
GO:1901861 1.33% regulation of muscle tissue development
GO:0016048 1.33% detection of temperature stimulus
GO:0006096 1.33% glycolytic process
GO:0002385 1.33% mucosal immune response
GO:0061245 1.33% establishment or maintenance of bipolar cell polarity
GO:0042364 1.33% water-soluble vitamin biosynthetic process
GO:0050000 1.33% chromosome localization
GO:0070920 1.33% regulation of production of small RNA involved in gene silencing by RNA
GO:2000114 1.33% regulation of establishment of cell polarity
GO:0042128 1.33% nitrate assimilation
GO:0002062 1.33% chondrocyte differentiation
GO:0045742 1.33% positive regulation of epidermal growth factor receptor signaling pathway
GO:1902117 1.33% positive regulation of organelle assembly
GO:0006260 1.33% DNA replication
GO:0045124 1.33% regulation of bone resorption
GO:0031341 1.33% regulation of cell killing
GO:2000573 1.33% positive regulation of DNA biosynthetic process
GO:0045475 1.32% locomotor rhythm
GO:0007274 1.32% neuromuscular synaptic transmission
GO:0006839 1.32% mitochondrial transport
GO:0045920 1.32% negative regulation of exocytosis
GO:0002026 1.32% regulation of the force of heart contraction
GO:0045638 1.32% negative regulation of myeloid cell differentiation
GO:0001837 1.32% epithelial to mesenchymal transition
GO:0002275 1.32% myeloid cell activation involved in immune response
GO:0016525 1.32% negative regulation of angiogenesis
GO:0032007 1.32% negative regulation of TOR signaling
GO:0062149 1.32% detection of stimulus involved in sensory perception of pain
GO:0007034 1.32% vacuolar transport
GO:1903076 1.32% regulation of protein localization to plasma membrane
GO:1900745 1.32% positive regulation of p38MAPK cascade
GO:0002703 1.32% regulation of leukocyte mediated immunity
GO:0007548 1.32% sex differentiation
GO:0035902 1.32% response to immobilization stress
GO:0006144 1.32% purine nucleobase metabolic process
GO:0016358 1.32% dendrite development
GO:0072594 1.32% establishment of protein localization to organelle
GO:0032024 1.32% positive regulation of insulin secretion
GO:0090659 1.32% walking behavior
GO:0033692 1.31% cellular polysaccharide biosynthetic process
GO:0019941 1.31% modification-dependent protein catabolic process
GO:0030511 1.31% positive regulation of transforming growth factor beta receptor signaling pathway
GO:0007044 1.31% cell-substrate junction assembly
GO:0002262 1.31% myeloid cell homeostasis
GO:0031645 1.31% negative regulation of nervous system process
GO:0032770 1.31% positive regulation of monooxygenase activity
GO:1900408 1.31% negative regulation of cellular response to oxidative stress
GO:0048863 1.31% stem cell differentiation
GO:0043489 1.31% RNA stabilization
GO:0046456 1.31% icosanoid biosynthetic process
GO:0033189 1.31% response to vitamin A
GO:0051647 1.31% nucleus localization
GO:0010830 1.31% regulation of myotube differentiation
GO:0009251 1.31% glucan catabolic process
GO:0002251 1.31% organ or tissue specific immune response
GO:0032732 1.31% positive regulation of interleukin-1 production
GO:0070613 1.31% regulation of protein processing
GO:0035282 1.31% segmentation
GO:0110020 1.31% regulation of actomyosin structure organization
GO:0043550 1.31% regulation of lipid kinase activity
GO:1901862 1.31% negative regulation of muscle tissue development
GO:0040028 1.30% regulation of vulval development
GO:0044247 1.30% cellular polysaccharide catabolic process
GO:0002443 1.30% leukocyte mediated immunity
GO:2000406 1.30% positive regulation of T cell migration
GO:0050731 1.30% positive regulation of peptidyl-tyrosine phosphorylation
GO:0006757 1.30% ATP generation from ADP
GO:0071545 1.30% inositol phosphate catabolic process
GO:0010517 1.30% regulation of phospholipase activity
GO:0007619 1.30% courtship behavior
GO:0043632 1.30% modification-dependent macromolecule catabolic process
GO:0048738 1.30% cardiac muscle tissue development
GO:0006833 1.30% water transport
GO:1903362 1.30% regulation of cellular protein catabolic process
GO:0010771 1.30% negative regulation of cell morphogenesis involved in differentiation
GO:0032330 1.30% regulation of chondrocyte differentiation
GO:0033005 1.30% positive regulation of mast cell activation
GO:0043406 1.30% positive regulation of MAP kinase activity
GO:0051262 1.30% protein tetramerization
GO:0014823 1.30% response to activity
GO:0050792 1.29% regulation of viral process
GO:0048240 1.29% sperm capacitation
GO:0090208 1.29% positive regulation of triglyceride metabolic process
GO:0008038 1.29% neuron recognition
GO:0010155 1.29% regulation of proton transport
GO:1901990 1.29% regulation of mitotic cell cycle phase transition
GO:0009555 1.29% pollen development
GO:1903792 1.29% negative regulation of anion transport
GO:0009799 1.29% specification of symmetry
GO:0009260 1.29% ribonucleotide biosynthetic process
GO:1903555 1.29% regulation of tumor necrosis factor superfamily cytokine production
GO:0006777 1.29% Mo-molybdopterin cofactor biosynthetic process
GO:0042403 1.29% thyroid hormone metabolic process
GO:0010717 1.29% regulation of epithelial to mesenchymal transition
GO:1903846 1.29% positive regulation of cellular response to transforming growth factor beta stimulus
GO:1902229 1.29% regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0043277 1.29% apoptotic cell clearance
GO:1903556 1.29% negative regulation of tumor necrosis factor superfamily cytokine production
GO:0007045 1.29% cell-substrate adherens junction assembly
GO:1901186 1.29% positive regulation of ERBB signaling pathway
GO:0043545 1.29% molybdopterin cofactor metabolic process
GO:0015748 1.28% organophosphate ester transport
GO:0046651 1.28% lymphocyte proliferation
GO:0001935 1.28% endothelial cell proliferation
GO:0072527 1.28% pyrimidine-containing compound metabolic process
GO:0050999 1.28% regulation of nitric-oxide synthase activity
GO:0034204 1.28% lipid translocation
GO:0032088 1.28% negative regulation of NF-kappaB transcription factor activity
GO:0071276 1.28% cellular response to cadmium ion
GO:0010633 1.28% negative regulation of epithelial cell migration
GO:0014075 1.28% response to amine
GO:0032878 1.28% regulation of establishment or maintenance of cell polarity
GO:0097530 1.28% granulocyte migration
GO:0051189 1.28% prosthetic group metabolic process
GO:0048041 1.28% focal adhesion assembly
GO:0010596 1.28% negative regulation of endothelial cell migration
GO:0032259 1.28% methylation
GO:0006586 1.28% indolalkylamine metabolic process
GO:0061041 1.28% regulation of wound healing
GO:0002758 1.28% innate immune response-activating signal transduction
GO:1903900 1.27% regulation of viral life cycle
GO:0048635 1.27% negative regulation of muscle organ development
GO:1903523 1.27% negative regulation of blood circulation
GO:0032653 1.27% regulation of interleukin-10 production
GO:0042462 1.27% eye photoreceptor cell development
GO:1902230 1.27% negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0042908 1.27% xenobiotic transport
GO:0055001 1.27% muscle cell development
GO:0050685 1.27% positive regulation of mRNA processing
GO:0006402 1.27% mRNA catabolic process
GO:0007214 1.27% gamma-aminobutyric acid signaling pathway
GO:0010595 1.27% positive regulation of endothelial cell migration
GO:0006412 1.27% translation
GO:0048679 1.27% regulation of axon regeneration
GO:0031503 1.27% protein-containing complex localization
GO:0031056 1.26% regulation of histone modification
GO:0001659 1.26% temperature homeostasis
GO:0046605 1.26% regulation of centrosome cycle
GO:0050873 1.26% brown fat cell differentiation
GO:0070085 1.26% glycosylation
GO:0045922 1.26% negative regulation of fatty acid metabolic process
GO:0002920 1.26% regulation of humoral immune response
GO:0014015 1.26% positive regulation of gliogenesis
GO:1904706 1.26% negative regulation of vascular smooth muscle cell proliferation
GO:0051489 1.26% regulation of filopodium assembly
GO:0043114 1.26% regulation of vascular permeability
GO:0042461 1.26% photoreceptor cell development
GO:0046113 1.26% nucleobase catabolic process
GO:0043543 1.26% protein acylation
GO:0007006 1.26% mitochondrial membrane organization
GO:0071103 1.26% DNA conformation change
GO:0032757 1.26% positive regulation of interleukin-8 production
GO:0017156 1.26% calcium-ion regulated exocytosis
GO:0043502 1.26% regulation of muscle adaptation
GO:0051291 1.26% protein heterooligomerization
GO:0035904 1.26% aorta development
GO:0033146 1.26% regulation of intracellular estrogen receptor signaling pathway
GO:0019720 1.26% Mo-molybdopterin cofactor metabolic process
GO:0016239 1.26% positive regulation of macroautophagy
GO:0006637 1.26% acyl-CoA metabolic process
GO:0001578 1.26% microtubule bundle formation
GO:0043161 1.26% proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0071621 1.26% granulocyte chemotaxis
GO:0002040 1.25% sprouting angiogenesis
GO:0071071 1.25% regulation of phospholipid biosynthetic process
GO:0042220 1.25% response to cocaine
GO:0006304 1.25% DNA modification
GO:0060325 1.25% face morphogenesis
GO:0061512 1.25% protein localization to cilium
GO:0006577 1.25% amino-acid betaine metabolic process
GO:1902107 1.25% positive regulation of leukocyte differentiation
GO:0010714 1.25% positive regulation of collagen metabolic process
GO:0007031 1.25% peroxisome organization
GO:0035383 1.25% thioester metabolic process
GO:0007614 1.25% short-term memory
GO:2000648 1.25% positive regulation of stem cell proliferation
GO:0032981 1.25% mitochondrial respiratory chain complex I assembly
GO:0060429 1.25% epithelium development
GO:0007498 1.25% mesoderm development
GO:0055075 1.25% potassium ion homeostasis
GO:0010738 1.25% regulation of protein kinase A signaling
GO:0060041 1.25% retina development in camera-type eye
GO:0002312 1.25% B cell activation involved in immune response
GO:0045687 1.25% positive regulation of glial cell differentiation
GO:0071230 1.25% cellular response to amino acid stimulus
GO:2000191 1.25% regulation of fatty acid transport
GO:0010259 1.25% multicellular organism aging
GO:0002764 1.25% immune response-regulating signaling pathway
GO:0045851 1.24% pH reduction
GO:0098813 1.24% nuclear chromosome segregation
GO:0042773 1.24% ATP synthesis coupled electron transport
GO:0010257 1.24% NADH dehydrogenase complex assembly
GO:0048762 1.24% mesenchymal cell differentiation
GO:0042129 1.24% regulation of T cell proliferation
GO:0035088 1.24% establishment or maintenance of apical/basal cell polarity
GO:0009067 1.24% aspartate family amino acid biosynthetic process
GO:0031057 1.24% negative regulation of histone modification
GO:0090630 1.24% activation of GTPase activity
GO:0070661 1.24% leukocyte proliferation
GO:0090049 1.24% regulation of cell migration involved in sprouting angiogenesis
GO:1904892 1.24% regulation of receptor signaling pathway via STAT
GO:0002757 1.24% immune response-activating signal transduction
GO:1990830 1.24% cellular response to leukemia inhibitory factor
GO:0051170 1.24% import into nucleus
GO:0008356 1.24% asymmetric cell division
GO:0140013 1.24% meiotic nuclear division
GO:1901385 1.23% regulation of voltage-gated calcium channel activity
GO:0030593 1.23% neutrophil chemotaxis
GO:0009309 1.23% amine biosynthetic process
GO:0001953 1.23% negative regulation of cell-matrix adhesion
GO:0006612 1.23% protein targeting to membrane
GO:0051155 1.23% positive regulation of striated muscle cell differentiation
GO:1900274 1.23% regulation of phospholipase C activity
GO:0045807 1.23% positive regulation of endocytosis
GO:0018345 1.23% protein palmitoylation
GO:0030098 1.23% lymphocyte differentiation
GO:0051560 1.23% mitochondrial calcium ion homeostasis
GO:1903707 1.23% negative regulation of hemopoiesis
GO:1990823 1.23% response to leukemia inhibitory factor
GO:0001541 1.23% ovarian follicle development
GO:0008608 1.23% attachment of spindle microtubules to kinetochore
GO:0010623 1.23% programmed cell death involved in cell development
GO:2001022 1.23% positive regulation of response to DNA damage stimulus
GO:0021766 1.23% hippocampus development
GO:0051153 1.23% regulation of striated muscle cell differentiation
GO:0008645 1.23% hexose transmembrane transport
GO:1903306 1.23% negative regulation of regulated secretory pathway
GO:0050670 1.23% regulation of lymphocyte proliferation
GO:0007628 1.23% adult walking behavior
GO:0032689 1.23% negative regulation of interferon-gamma production
GO:0006568 1.23% tryptophan metabolic process
GO:0060760 1.23% positive regulation of response to cytokine stimulus
GO:0048489 1.22% synaptic vesicle transport
GO:0001778 1.22% plasma membrane repair
GO:0002227 1.22% innate immune response in mucosa
GO:0022617 1.22% extracellular matrix disassembly
GO:0032943 1.22% mononuclear cell proliferation
GO:1900047 1.22% negative regulation of hemostasis
GO:0014066 1.22% regulation of phosphatidylinositol 3-kinase signaling
GO:0042417 1.22% dopamine metabolic process
GO:0030728 1.22% ovulation
GO:0046847 1.22% filopodium assembly
GO:0006825 1.22% copper ion transport
GO:0050919 1.22% negative chemotaxis
GO:0050867 1.22% positive regulation of cell activation
GO:0098801 1.22% regulation of renal system process
GO:0014743 1.22% regulation of muscle hypertrophy
GO:0010389 1.22% regulation of G2/M transition of mitotic cell cycle
GO:2001236 1.22% regulation of extrinsic apoptotic signaling pathway
GO:0001952 1.22% regulation of cell-matrix adhesion
GO:0033617 1.22% mitochondrial respiratory chain complex IV assembly
GO:0009855 1.22% determination of bilateral symmetry
GO:0002066 1.22% columnar/cuboidal epithelial cell development
GO:0048169 1.22% regulation of long-term neuronal synaptic plasticity
GO:0002931 1.21% response to ischemia
GO:0016331 1.21% morphogenesis of embryonic epithelium
GO:0048048 1.21% embryonic eye morphogenesis
GO:0006639 1.21% acylglycerol metabolic process
GO:0050892 1.21% intestinal absorption
GO:1901018 1.21% positive regulation of potassium ion transmembrane transporter activity
GO:0071560 1.21% cellular response to transforming growth factor beta stimulus
GO:0043950 1.21% positive regulation of cAMP-mediated signaling
GO:0045332 1.21% phospholipid translocation
GO:0051250 1.21% negative regulation of lymphocyte activation
GO:0030513 1.21% positive regulation of BMP signaling pathway
GO:0001975 1.21% response to amphetamine
GO:0032944 1.21% regulation of mononuclear cell proliferation
GO:0046622 1.21% positive regulation of organ growth
GO:0070997 1.21% neuron death
GO:1903363 1.21% negative regulation of cellular protein catabolic process
GO:0055006 1.21% cardiac cell development
GO:0035640 1.21% exploration behavior
GO:0009437 1.21% carnitine metabolic process
GO:0017004 1.21% cytochrome complex assembly
GO:0071852 1.21% fungal-type cell wall organization or biogenesis
GO:0050770 1.20% regulation of axonogenesis
GO:0009658 1.20% chloroplast organization
GO:0071300 1.20% cellular response to retinoic acid
GO:0030199 1.20% collagen fibril organization
GO:0031110 1.20% regulation of microtubule polymerization or depolymerization
GO:2000765 1.20% regulation of cytoplasmic translation
GO:0051651 1.20% maintenance of location in cell
GO:0006448 1.20% regulation of translational elongation
GO:0032873 1.20% negative regulation of stress-activated MAPK cascade
GO:1905268 1.20% negative regulation of chromatin organization
GO:0048544 1.20% recognition of pollen
GO:0043299 1.20% leukocyte degranulation
GO:0019369 1.20% arachidonic acid metabolic process
GO:1903313 1.20% positive regulation of mRNA metabolic process
GO:0007588 1.20% excretion
GO:0070646 1.20% protein modification by small protein removal
GO:0002052 1.20% positive regulation of neuroblast proliferation
GO:0009247 1.20% glycolipid biosynthetic process
GO:1903429 1.20% regulation of cell maturation
GO:0006333 1.20% chromatin assembly or disassembly
GO:0045923 1.20% positive regulation of fatty acid metabolic process
GO:1901796 1.20% regulation of signal transduction by p53 class mediator
GO:0002696 1.20% positive regulation of leukocyte activation
GO:0070206 1.20% protein trimerization
GO:0045646 1.20% regulation of erythrocyte differentiation
GO:1903557 1.20% positive regulation of tumor necrosis factor superfamily cytokine production
GO:0008535 1.20% respiratory chain complex IV assembly
GO:1901661 1.20% quinone metabolic process
GO:0030183 1.20% B cell differentiation
GO:0048193 1.19% Golgi vesicle transport
GO:0046330 1.19% positive regulation of JNK cascade
GO:0033344 1.19% cholesterol efflux
GO:0034504 1.19% protein localization to nucleus
GO:0055010 1.19% ventricular cardiac muscle tissue morphogenesis
GO:0002335 1.19% mature B cell differentiation
GO:0051181 1.19% cofactor transport
GO:0007097 1.19% nuclear migration
GO:0006511 1.19% ubiquitin-dependent protein catabolic process
GO:0071674 1.19% mononuclear cell migration
GO:0002260 1.19% lymphocyte homeostasis
GO:0045721 1.19% negative regulation of gluconeogenesis
GO:0001658 1.19% branching involved in ureteric bud morphogenesis
GO:0120193 1.19% tight junction organization
GO:1904262 1.19% negative regulation of TORC1 signaling
GO:0051445 1.19% regulation of meiotic cell cycle
GO:1902115 1.19% regulation of organelle assembly
GO:0001756 1.19% somitogenesis
GO:0032675 1.19% regulation of interleukin-6 production
GO:0042182 1.19% ketone catabolic process
GO:0051385 1.19% response to mineralocorticoid
GO:0051668 1.19% localization within membrane
GO:0051865 1.19% protein autoubiquitination
GO:0040019 1.19% positive regulation of embryonic development
GO:0010611 1.19% regulation of cardiac muscle hypertrophy
GO:0051648 1.19% vesicle localization
GO:0035094 1.19% response to nicotine
GO:0002715 1.19% regulation of natural killer cell mediated immunity
GO:0051452 1.19% intracellular pH reduction
GO:0006401 1.19% RNA catabolic process
GO:0070570 1.19% regulation of neuron projection regeneration
GO:0000018 1.18% regulation of DNA recombination
GO:0097061 1.18% dendritic spine organization
GO:0042762 1.18% regulation of sulfur metabolic process
GO:0120032 1.18% regulation of plasma membrane bounded cell projection assembly
GO:0046640 1.18% regulation of alpha-beta T cell proliferation
GO:0055002 1.18% striated muscle cell development
GO:0034250 1.18% positive regulation of cellular amide metabolic process
GO:0071731 1.18% response to nitric oxide
GO:1901678 1.18% iron coordination entity transport
GO:0010498 1.18% proteasomal protein catabolic process
GO:0030195 1.18% negative regulation of blood coagulation
GO:0098661 1.18% inorganic anion transmembrane transport
GO:0052803 1.18% imidazole-containing compound metabolic process
GO:1904356 1.18% regulation of telomere maintenance via telomere lengthening
GO:0001678 1.18% cellular glucose homeostasis
GO:2000463 1.18% positive regulation of excitatory postsynaptic potential
GO:0072525 1.18% pyridine-containing compound biosynthetic process
GO:0034105 1.18% positive regulation of tissue remodeling
GO:0035418 1.18% protein localization to synapse
GO:0007190 1.18% activation of adenylate cyclase activity
GO:0090698 1.18% post-embryonic plant morphogenesis
GO:0036075 1.18% replacement ossification
GO:0042401 1.18% cellular biogenic amine biosynthetic process
GO:0010165 1.18% response to X-ray
GO:2000404 1.18% regulation of T cell migration
GO:0002768 1.18% immune response-regulating cell surface receptor signaling pathway
GO:0071677 1.18% positive regulation of mononuclear cell migration
GO:0048771 1.18% tissue remodeling
GO:1903037 1.18% regulation of leukocyte cell-cell adhesion
GO:0043624 1.17% cellular protein complex disassembly
GO:0006573 1.17% valine metabolic process
GO:0098751 1.17% bone cell development
GO:0034333 1.17% adherens junction assembly
GO:0042733 1.17% embryonic digit morphogenesis
GO:0032204 1.17% regulation of telomere maintenance
GO:0001958 1.17% endochondral ossification
GO:0002429 1.17% immune response-activating cell surface receptor signaling pathway
GO:0042269 1.17% regulation of natural killer cell mediated cytotoxicity
GO:2001238 1.17% positive regulation of extrinsic apoptotic signaling pathway
GO:0046824 1.17% positive regulation of nucleocytoplasmic transport
GO:0021987 1.17% cerebral cortex development
GO:0045686 1.17% negative regulation of glial cell differentiation
GO:0140029 1.17% exocytic process
GO:0060976 1.17% coronary vasculature development
GO:0002067 1.17% glandular epithelial cell differentiation
GO:0046349 1.17% amino sugar biosynthetic process
GO:0072523 1.17% purine-containing compound catabolic process
GO:0007368 1.17% determination of left/right symmetry
GO:0046058 1.17% cAMP metabolic process
GO:0031505 1.17% fungal-type cell wall organization
GO:0048013 1.17% ephrin receptor signaling pathway
GO:0045490 1.17% pectin catabolic process
GO:0051303 1.17% establishment of chromosome localization
GO:0051446 1.17% positive regulation of meiotic cell cycle
GO:0050688 1.17% regulation of defense response to virus
GO:0016102 1.17% diterpenoid biosynthetic process
GO:0051496 1.16% positive regulation of stress fiber assembly
GO:2000142 1.16% regulation of DNA-templated transcription, initiation
GO:0051150 1.16% regulation of smooth muscle cell differentiation
GO:0010824 1.16% regulation of centrosome duplication
GO:0010950 1.16% positive regulation of endopeptidase activity
GO:0032722 1.16% positive regulation of chemokine production
GO:0070303 1.16% negative regulation of stress-activated protein kinase signaling cascade
GO:0043300 1.16% regulation of leukocyte degranulation
GO:0010831 1.16% positive regulation of myotube differentiation
GO:0006949 1.16% syncytium formation
GO:1901224 1.16% positive regulation of NIK/NF-kappaB signaling
GO:0016072 1.16% rRNA metabolic process
GO:0099024 1.16% plasma membrane invagination
GO:2000171 1.16% negative regulation of dendrite development
GO:0006020 1.16% inositol metabolic process
GO:0007297 1.16% ovarian follicle cell migration
GO:0071806 1.16% protein transmembrane transport
GO:0045197 1.16% establishment or maintenance of epithelial cell apical/basal polarity
GO:0010952 1.16% positive regulation of peptidase activity
GO:0006638 1.16% neutral lipid metabolic process
GO:1901983 1.16% regulation of protein acetylation
GO:0052126 1.16% movement in host environment
GO:0031343 1.16% positive regulation of cell killing
GO:0072522 1.15% purine-containing compound biosynthetic process
GO:0090559 1.15% regulation of membrane permeability
GO:0002097 1.15% tRNA wobble base modification
GO:2001243 1.15% negative regulation of intrinsic apoptotic signaling pathway
GO:0048821 1.15% erythrocyte development
GO:0016079 1.15% synaptic vesicle exocytosis
GO:0051281 1.15% positive regulation of release of sequestered calcium ion into cytosol
GO:0007416 1.15% synapse assembly
GO:0051149 1.15% positive regulation of muscle cell differentiation
GO:0031069 1.15% hair follicle morphogenesis
GO:2000772 1.15% regulation of cellular senescence
GO:0019228 1.15% neuronal action potential
GO:0030514 1.15% negative regulation of BMP signaling pathway
GO:0035435 1.15% phosphate ion transmembrane transport
GO:0120192 1.15% tight junction assembly
GO:0010765 1.15% positive regulation of sodium ion transport
GO:0071479 1.15% cellular response to ionizing radiation
GO:1903672 1.15% positive regulation of sprouting angiogenesis
GO:0006549 1.15% isoleucine metabolic process
GO:0002183 1.15% cytoplasmic translational initiation
GO:0006206 1.14% pyrimidine nucleobase metabolic process
GO:0007041 1.14% lysosomal transport
GO:0072676 1.14% lymphocyte migration
GO:2001252 1.14% positive regulation of chromosome organization
GO:0090263 1.14% positive regulation of canonical Wnt signaling pathway
GO:0050482 1.14% arachidonic acid secretion
GO:0060706 1.14% cell differentiation involved in embryonic placenta development
GO:0090305 1.14% nucleic acid phosphodiester bond hydrolysis
GO:0009954 1.14% proximal/distal pattern formation
GO:0001556 1.14% oocyte maturation
GO:0030952 1.14% establishment or maintenance of cytoskeleton polarity
GO:0035116 1.14% embryonic hindlimb morphogenesis
GO:0042398 1.14% cellular modified amino acid biosynthetic process
GO:1904037 1.14% positive regulation of epithelial cell apoptotic process
GO:1902373 1.14% negative regulation of mRNA catabolic process
GO:0002098 1.14% tRNA wobble uridine modification
GO:0044257 1.14% cellular protein catabolic process
GO:0000082 1.14% G1/S transition of mitotic cell cycle
GO:0050886 1.14% endocrine process
GO:0006120 1.14% mitochondrial electron transport, NADH to ubiquinone
GO:0046425 1.14% regulation of receptor signaling pathway via JAK-STAT
GO:0099643 1.14% signal release from synapse
GO:0001961 1.14% positive regulation of cytokine-mediated signaling pathway
GO:0032760 1.14% positive regulation of tumor necrosis factor production
GO:0006884 1.14% cell volume homeostasis
GO:0140056 1.14% organelle localization by membrane tethering
GO:0009100 1.13% glycoprotein metabolic process
GO:0010866 1.13% regulation of triglyceride biosynthetic process
GO:0140115 1.13% export across plasma membrane
GO:0032309 1.13% icosanoid secretion
GO:1905330 1.13% regulation of morphogenesis of an epithelium
GO:0010660 1.13% regulation of muscle cell apoptotic process
GO:0042255 1.13% ribosome assembly
GO:0070192 1.13% chromosome organization involved in meiotic cell cycle
GO:0045684 1.13% positive regulation of epidermis development
GO:0010863 1.13% positive regulation of phospholipase C activity
GO:0003156 1.13% regulation of animal organ formation
GO:0090174 1.13% organelle membrane fusion
GO:0001782 1.13% B cell homeostasis
GO:0002548 1.13% monocyte chemotaxis
GO:0071312 1.13% cellular response to alkaloid
GO:0030516 1.13% regulation of axon extension
GO:0072665 1.13% protein localization to vacuole
GO:0070584 1.13% mitochondrion morphogenesis
GO:0065004 1.13% protein-DNA complex assembly
GO:0009250 1.13% glucan biosynthetic process
GO:0006606 1.13% protein import into nucleus
GO:1903307 1.13% positive regulation of regulated secretory pathway
GO:0051354 1.13% negative regulation of oxidoreductase activity
GO:0035162 1.13% embryonic hemopoiesis
GO:0032692 1.13% negative regulation of interleukin-1 production
GO:0010837 1.13% regulation of keratinocyte proliferation
GO:0034332 1.13% adherens junction organization
GO:0006047 1.13% UDP-N-acetylglucosamine metabolic process
GO:0061458 1.13% reproductive system development
GO:1903008 1.12% organelle disassembly
GO:0110110 1.12% positive regulation of animal organ morphogenesis
GO:0098534 1.12% centriole assembly
GO:0032967 1.12% positive regulation of collagen biosynthetic process
GO:0051315 1.12% attachment of mitotic spindle microtubules to kinetochore
GO:2000058 1.12% regulation of ubiquitin-dependent protein catabolic process
GO:2000311 1.12% regulation of AMPA receptor activity
GO:0046068 1.12% cGMP metabolic process
GO:0044843 1.12% cell cycle G1/S phase transition
GO:0055092 1.12% sterol homeostasis
GO:0046185 1.12% aldehyde catabolic process
GO:0044273 1.12% sulfur compound catabolic process
GO:0036314 1.12% response to sterol
GO:0009664 1.12% plant-type cell wall organization
GO:2001039 1.12% negative regulation of cellular response to drug
GO:0051251 1.12% positive regulation of lymphocyte activation
GO:1903053 1.12% regulation of extracellular matrix organization
GO:0021533 1.12% cell differentiation in hindbrain
GO:0000723 1.12% telomere maintenance
GO:0009084 1.12% glutamine family amino acid biosynthetic process
GO:0050680 1.12% negative regulation of epithelial cell proliferation
GO:0019882 1.12% antigen processing and presentation
GO:0048002 1.12% antigen processing and presentation of peptide antigen
GO:1902600 1.11% proton transmembrane transport
GO:0034198 1.11% cellular response to amino acid starvation
GO:0032649 1.11% regulation of interferon-gamma production
GO:0046148 1.11% pigment biosynthetic process
GO:0016579 1.11% protein deubiquitination
GO:0065005 1.11% protein-lipid complex assembly
GO:0071322 1.11% cellular response to carbohydrate stimulus
GO:0042110 1.11% T cell activation
GO:1903038 1.11% negative regulation of leukocyte cell-cell adhesion
GO:0033688 1.11% regulation of osteoblast proliferation
GO:0018210 1.11% peptidyl-threonine modification
GO:1900544 1.11% positive regulation of purine nucleotide metabolic process
GO:0000075 1.11% cell cycle checkpoint
GO:0034698 1.11% response to gonadotropin
GO:0009262 1.11% deoxyribonucleotide metabolic process
GO:0042558 1.11% pteridine-containing compound metabolic process
GO:0018200 1.11% peptidyl-glutamic acid modification
GO:0007492 1.11% endoderm development
GO:0043506 1.11% regulation of JUN kinase activity
GO:0000096 1.11% sulfur amino acid metabolic process
GO:0006473 1.11% protein acetylation
GO:2000279 1.11% negative regulation of DNA biosynthetic process
GO:0001910 1.10% regulation of leukocyte mediated cytotoxicity
GO:0008333 1.10% endosome to lysosome transport
GO:0051146 1.10% striated muscle cell differentiation
GO:0055013 1.10% cardiac muscle cell development
GO:0090278 1.10% negative regulation of peptide hormone secretion
GO:0032755 1.10% positive regulation of interleukin-6 production
GO:1902884 1.10% positive regulation of response to oxidative stress
GO:0006910 1.10% phagocytosis, recognition
GO:0007007 1.10% inner mitochondrial membrane organization
GO:0006282 1.10% regulation of DNA repair
GO:0032774 1.10% RNA biosynthetic process
GO:0006534 1.10% cysteine metabolic process
GO:1903963 1.10% arachidonate transport
GO:0032869 1.10% cellular response to insulin stimulus
GO:0030218 1.10% erythrocyte differentiation
GO:1901988 1.10% negative regulation of cell cycle phase transition
GO:0006547 1.10% histidine metabolic process
GO:0045671 1.10% negative regulation of osteoclast differentiation
GO:0009948 1.10% anterior/posterior axis specification
GO:0043650 1.10% dicarboxylic acid biosynthetic process
GO:0061982 1.10% meiosis I cell cycle process
GO:0007159 1.10% leukocyte cell-cell adhesion
GO:0006094 1.10% gluconeogenesis
GO:0002495 1.10% antigen processing and presentation of peptide antigen via MHC class II
GO:0071375 1.09% cellular response to peptide hormone stimulus
GO:0007143 1.09% female meiotic nuclear division
GO:0006733 1.09% oxidoreduction coenzyme metabolic process
GO:0045648 1.09% positive regulation of erythrocyte differentiation
GO:0046364 1.09% monosaccharide biosynthetic process
GO:1902750 1.09% negative regulation of cell cycle G2/M phase transition
GO:0031122 1.09% cytoplasmic microtubule organization
GO:0006305 1.09% DNA alkylation
GO:0061387 1.09% regulation of extent of cell growth
GO:0051279 1.09% regulation of release of sequestered calcium ion into cytosol
GO:0016073 1.09% snRNA metabolic process
GO:1904427 1.09% positive regulation of calcium ion transmembrane transport
GO:0072384 1.09% organelle transport along microtubule
GO:0000725 1.09% recombinational repair
GO:0150104 1.09% transport across blood-brain barrier
GO:0042632 1.09% cholesterol homeostasis
GO:0009953 1.09% dorsal/ventral pattern formation
GO:0070723 1.09% response to cholesterol
GO:0031396 1.09% regulation of protein ubiquitination
GO:0031529 1.09% ruffle organization
GO:0015909 1.09% long-chain fatty acid transport
GO:2000677 1.09% regulation of transcription regulatory region DNA binding
GO:0032210 1.08% regulation of telomere maintenance via telomerase
GO:0032200 1.08% telomere organization
GO:0006636 1.08% unsaturated fatty acid biosynthetic process
GO:0032272 1.08% negative regulation of protein polymerization
GO:0046823 1.08% negative regulation of nucleocytoplasmic transport
GO:0007272 1.08% ensheathment of neurons
GO:0090313 1.08% regulation of protein targeting to membrane
GO:0002090 1.08% regulation of receptor internalization
GO:1990961 1.08% xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0043414 1.08% macromolecule methylation
GO:0090501 1.08% RNA phosphodiester bond hydrolysis
GO:0009152 1.08% purine ribonucleotide biosynthetic process
GO:0010842 1.08% retina layer formation
GO:1903319 1.08% positive regulation of protein maturation
GO:0090303 1.08% positive regulation of wound healing
GO:0042552 1.08% myelination
GO:0051224 1.08% negative regulation of protein transport
GO:0006306 1.08% DNA methylation
GO:2000045 1.08% regulation of G1/S transition of mitotic cell cycle
GO:0032231 1.08% regulation of actin filament bundle assembly
GO:0052192 1.08% movement in environment of other organism involved in symbiotic interaction
GO:0016556 1.08% mRNA modification
GO:0010955 1.08% negative regulation of protein processing
GO:0030878 1.08% thyroid gland development
GO:0006553 1.08% lysine metabolic process
GO:0008366 1.07% axon ensheathment
GO:0048536 1.07% spleen development
GO:1903203 1.07% regulation of oxidative stress-induced neuron death
GO:0008207 1.07% C21-steroid hormone metabolic process
GO:0033198 1.07% response to ATP
GO:0001776 1.07% leukocyte homeostasis
GO:0042059 1.07% negative regulation of epidermal growth factor receptor signaling pathway
GO:0008088 1.07% axo-dendritic transport
GO:0030517 1.07% negative regulation of axon extension
GO:0016236 1.07% macroautophagy
GO:0006403 1.07% RNA localization
GO:0006551 1.07% leucine metabolic process
GO:0019319 1.07% hexose biosynthetic process
GO:0007369 1.07% gastrulation
GO:0044728 1.07% DNA methylation or demethylation
GO:0022008 1.07% neurogenesis
GO:0006956 1.07% complement activation
GO:0015914 1.07% phospholipid transport
GO:0042130 1.07% negative regulation of T cell proliferation
GO:1902106 1.07% negative regulation of leukocyte differentiation
GO:2000059 1.07% negative regulation of ubiquitin-dependent protein catabolic process
GO:0031507 1.07% heterochromatin assembly
GO:0010324 1.07% membrane invagination
GO:0008589 1.07% regulation of smoothened signaling pathway
GO:0002705 1.07% positive regulation of leukocyte mediated immunity
GO:0032197 1.07% transposition, RNA-mediated
GO:0006364 1.07% rRNA processing
GO:0002504 1.07% antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:1904950 1.07% negative regulation of establishment of protein localization
GO:0046825 1.06% regulation of protein export from nucleus
GO:0006310 1.06% DNA recombination
GO:0010821 1.06% regulation of mitochondrion organization
GO:0051646 1.06% mitochondrion localization
GO:0070828 1.06% heterochromatin organization
GO:1900101 1.06% regulation of endoplasmic reticulum unfolded protein response
GO:0009101 1.06% glycoprotein biosynthetic process
GO:0051492 1.06% regulation of stress fiber assembly
GO:0043407 1.06% negative regulation of MAP kinase activity
GO:0000724 1.06% double-strand break repair via homologous recombination
GO:2000736 1.06% regulation of stem cell differentiation
GO:0045954 1.06% positive regulation of natural killer cell mediated cytotoxicity
GO:0050771 1.06% negative regulation of axonogenesis
GO:1904659 1.06% glucose transmembrane transport
GO:0032642 1.06% regulation of chemokine production
GO:0035914 1.06% skeletal muscle cell differentiation
GO:0050982 1.06% detection of mechanical stimulus
GO:2001239 1.06% regulation of extrinsic apoptotic signaling pathway in absence of ligand
GO:0060291 1.06% long-term synaptic potentiation
GO:1900182 1.05% positive regulation of protein localization to nucleus
GO:0000266 1.05% mitochondrial fission
GO:0043044 1.05% ATP-dependent chromatin remodeling
GO:0072583 1.05% clathrin-dependent endocytosis
GO:1903050 1.05% regulation of proteolysis involved in cellular protein catabolic process
GO:0032731 1.05% positive regulation of interleukin-1 beta production
GO:0042157 1.05% lipoprotein metabolic process
GO:0002720 1.05% positive regulation of cytokine production involved in immune response
GO:0002460 1.05% adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032092 1.05% positive regulation of protein binding
GO:0046676 1.05% negative regulation of insulin secretion
GO:0002888 1.05% positive regulation of myeloid leukocyte mediated immunity
GO:0060143 1.05% positive regulation of syncytium formation by plasma membrane fusion
GO:0042098 1.05% T cell proliferation
GO:0045103 1.05% intermediate filament-based process
GO:1900015 1.05% regulation of cytokine production involved in inflammatory response
GO:1903727 1.05% positive regulation of phospholipid metabolic process
GO:0021510 1.05% spinal cord development
GO:0007035 1.05% vacuolar acidification
GO:0022406 1.05% membrane docking
GO:0016036 1.05% cellular response to phosphate starvation
GO:2000117 1.05% negative regulation of cysteine-type endopeptidase activity
GO:1902170 1.05% cellular response to reactive nitrogen species
GO:0006164 1.04% purine nucleotide biosynthetic process
GO:0070328 1.04% triglyceride homeostasis
GO:0051125 1.04% regulation of actin nucleation
GO:1904376 1.04% negative regulation of protein localization to cell periphery
GO:0021549 1.04% cerebellum development
GO:0055090 1.04% acylglycerol homeostasis
GO:0097479 1.04% synaptic vesicle localization
GO:0009395 1.04% phospholipid catabolic process
GO:0046427 1.04% positive regulation of receptor signaling pathway via JAK-STAT
GO:0140238 1.04% presynaptic endocytosis
GO:2000756 1.04% regulation of peptidyl-lysine acetylation
GO:0006858 1.04% extracellular transport
GO:1901185 1.04% negative regulation of ERBB signaling pathway
GO:0045010 1.04% actin nucleation
GO:0010614 1.04% negative regulation of cardiac muscle hypertrophy
GO:0031063 1.04% regulation of histone deacetylation
GO:0043302 1.04% positive regulation of leukocyte degranulation
GO:0060260 1.04% regulation of transcription initiation from RNA polymerase II promoter
GO:0007020 1.04% microtubule nucleation
GO:1901797 1.04% negative regulation of signal transduction by p53 class mediator
GO:0031365 1.04% N-terminal protein amino acid modification
GO:0097035 1.04% regulation of membrane lipid distribution
GO:0032467 1.04% positive regulation of cytokinesis
GO:0035114 1.04% imaginal disc-derived appendage morphogenesis
GO:0055117 1.04% regulation of cardiac muscle contraction
GO:0035809 1.04% regulation of urine volume
GO:0045132 1.04% meiotic chromosome segregation
GO:1905879 1.04% regulation of oogenesis
GO:0031638 1.04% zymogen activation
GO:0046856 1.04% phosphatidylinositol dephosphorylation
GO:0045453 1.04% bone resorption
GO:1902042 1.04% negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0045069 1.04% regulation of viral genome replication
GO:0061005 1.04% cell differentiation involved in kidney development
GO:0034620 1.04% cellular response to unfolded protein
GO:0048103 1.03% somatic stem cell division
GO:0045724 1.03% positive regulation of cilium assembly
GO:1990090 1.03% cellular response to nerve growth factor stimulus
GO:0006351 1.03% transcription, DNA-templated
GO:0071825 1.03% protein-lipid complex subunit organization
GO:0010719 1.03% negative regulation of epithelial to mesenchymal transition
GO:0097659 1.03% nucleic acid-templated transcription
GO:0006110 1.03% regulation of glycolytic process
GO:0006997 1.03% nucleus organization
GO:0050974 1.03% detection of mechanical stimulus involved in sensory perception
GO:0045981 1.03% positive regulation of nucleotide metabolic process
GO:0002286 1.03% T cell activation involved in immune response
GO:0098581 1.03% detection of external biotic stimulus
GO:0000377 1.03% RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0002717 1.03% positive regulation of natural killer cell mediated immunity
GO:0044272 1.03% sulfur compound biosynthetic process
GO:0051402 1.03% neuron apoptotic process
GO:0050850 1.03% positive regulation of calcium-mediated signaling
GO:0034656 1.03% nucleobase-containing small molecule catabolic process
GO:0003007 1.03% heart morphogenesis
GO:0070988 1.03% demethylation
GO:1905953 1.03% negative regulation of lipid localization
GO:0003015 1.03% heart process
GO:0006022 1.03% aminoglycan metabolic process
GO:0050868 1.03% negative regulation of T cell activation
GO:0045576 1.03% mast cell activation
GO:0016197 1.03% endosomal transport
GO:1902806 1.03% regulation of cell cycle G1/S phase transition
GO:0048255 1.03% mRNA stabilization
GO:0003085 1.03% negative regulation of systemic arterial blood pressure
GO:1904894 1.03% positive regulation of receptor signaling pathway via STAT
GO:0002082 1.03% regulation of oxidative phosphorylation
GO:0033003 1.03% regulation of mast cell activation
GO:0002759 1.03% regulation of antimicrobial humoral response
GO:0071242 1.03% cellular response to ammonium ion
GO:0034341 1.02% response to interferon-gamma
GO:0051590 1.02% positive regulation of neurotransmitter transport
GO:0060322 1.02% head development
GO:0032434 1.02% regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0048488 1.02% synaptic vesicle endocytosis
GO:0010954 1.02% positive regulation of protein processing
GO:0032387 1.02% negative regulation of intracellular transport
GO:0002762 1.02% negative regulation of myeloid leukocyte differentiation
GO:0030243 1.02% cellulose metabolic process
GO:0032479 1.02% regulation of type I interferon production
GO:0042116 1.02% macrophage activation
GO:0043388 1.02% positive regulation of DNA binding
GO:0090183 1.02% regulation of kidney development
GO:0010529 1.02% negative regulation of transposition
GO:0002886 1.02% regulation of myeloid leukocyte mediated immunity
GO:1903318 1.02% negative regulation of protein maturation
GO:0043486 1.02% histone exchange
GO:0000086 1.02% G2/M transition of mitotic cell cycle
GO:1901020 1.02% negative regulation of calcium ion transmembrane transporter activity
GO:0006525 1.02% arginine metabolic process
GO:0090069 1.02% regulation of ribosome biogenesis
GO:0051310 1.02% metaphase plate congression
GO:0006656 1.02% phosphatidylcholine biosynthetic process
GO:0006906 1.02% vesicle fusion
GO:0002269 1.02% leukocyte activation involved in inflammatory response
GO:0046329 1.02% negative regulation of JNK cascade
GO:0035813 1.01% regulation of renal sodium excretion
GO:0032691 1.01% negative regulation of interleukin-1 beta production
GO:0019646 1.01% aerobic electron transport chain
GO:0043280 1.01% positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006544 1.01% glycine metabolic process
GO:0008154 1.01% actin polymerization or depolymerization
GO:0006984 1.01% ER-nucleus signaling pathway
GO:1903205 1.01% regulation of hydrogen peroxide-induced cell death
GO:1904030 1.01% negative regulation of cyclin-dependent protein kinase activity
GO:0032733 1.01% positive regulation of interleukin-10 production
GO:0000398 1.01% mRNA splicing, via spliceosome
GO:0032507 1.01% maintenance of protein location in cell
GO:0045910 1.01% negative regulation of DNA recombination
GO:0031497 1.01% chromatin assembly
GO:2001244 1.01% positive regulation of intrinsic apoptotic signaling pathway
GO:0050779 1.01% RNA destabilization
GO:0008045 1.01% motor neuron axon guidance
GO:1903115 1.01% regulation of actin filament-based movement
GO:1903779 1.01% regulation of cardiac conduction
GO:0072528 1.01% pyrimidine-containing compound biosynthetic process
GO:1905476 1.01% negative regulation of protein localization to membrane
GO:2001056 1.01% positive regulation of cysteine-type endopeptidase activity
GO:0001774 1.00% microglial cell activation
GO:2000104 1.00% negative regulation of DNA-dependent DNA replication
GO:0044319 1.00% wound healing, spreading of cells
GO:0035120 1.00% post-embryonic appendage morphogenesis
GO:0014014 1.00% negative regulation of gliogenesis
GO:0006958 1.00% complement activation, classical pathway
GO:0045823 1.00% positive regulation of heart contraction
GO:0042278 1.00% purine nucleoside metabolic process
GO:0030203 1.00% glycosaminoglycan metabolic process
GO:0031397 1.00% negative regulation of protein ubiquitination
GO:0001562 1.00% response to protozoan
GO:0031000 1.00% response to caffeine
GO:0018195 1.00% peptidyl-arginine modification
GO:0097755 1.00% positive regulation of blood vessel diameter
GO:0007030 1.00% Golgi organization
GO:0007099 1.00% centriole replication
GO:0033137 1.00% negative regulation of peptidyl-serine phosphorylation
GO:0006122 1.00% mitochondrial electron transport, ubiquinol to cytochrome c
GO:0001909 1.00% leukocyte mediated cytotoxicity
GO:0030318 1.00% melanocyte differentiation
GO:0009713 1.00% catechol-containing compound biosynthetic process
Back
Download
TOP