TOP
UniProt ID:
P02882
Entry Name:
MONB_DIOCU
Sequence:
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN
Molecular Function
Biological Process
Cellular Component
Score (%) 12.96~30.65
GO Terms Score Description
GO:0005575 30.65% cellular_component
GO:0061695 25.23% transferase complex, transferring phosphorus-containing groups
GO:0032991 23.81% protein-containing complex
GO:1902494 21.38% catalytic complex
GO:1990234 21.15% transferase complex
GO:0110165 21.09% cellular anatomical entity
GO:0043226 19.36% organelle
GO:0043229 19.06% intracellular organelle
GO:1902911 17.71% protein kinase complex
GO:1902554 17.67% serine/threonine protein kinase complex
GO:0005675 17.08% transcription factor TFIIH holo complex
GO:0043232 17.01% intracellular non-membrane-bounded organelle
GO:0043228 16.95% non-membrane-bounded organelle
GO:0005667 16.23% transcription factor complex
GO:0005829 15.89% cytosol
GO:0032806 15.86% carboxy-terminal domain protein kinase complex
GO:0043227 15.60% membrane-bounded organelle
GO:0043231 15.44% intracellular membrane-bounded organelle
GO:0005634 15.23% nucleus
GO:0005665 15.11% RNA polymerase II, core complex
GO:0005737 14.37% cytoplasm
GO:0030880 13.45% RNA polymerase complex
GO:0044798 13.08% nuclear transcription factor complex
GO:0005669 13.05% transcription factor TFIID complex
GO:0000428 12.96% DNA-directed RNA polymerase complex
GO:0055029 12.46% nuclear DNA-directed RNA polymerase complex
GO:0090575 12.15% RNA polymerase II transcription factor complex
GO:0005654 11.55% nucleoplasm
GO:0005666 10.43% RNA polymerase III complex
GO:0005730 10.02% nucleolus
GO:0099080 9.89% supramolecular complex
GO:1990904 9.00% ribonucleoprotein complex
GO:0017053 8.96% transcriptional repressor complex
GO:0005736 8.71% RNA polymerase I complex
GO:0000785 8.67% chromatin
GO:0016020 8.16% membrane
GO:1905348 7.96% endonuclease complex
GO:0005819 7.95% spindle
GO:0000152 7.77% nuclear ubiquitin ligase complex
GO:0031965 7.74% nuclear membrane
GO:0000776 7.69% kinetochore
GO:1902555 7.42% endoribonuclease complex
GO:1902493 6.88% acetyltransferase complex
GO:0005856 6.79% cytoskeleton
GO:0031248 6.69% protein acetyltransferase complex
GO:0031090 6.60% organelle membrane
GO:0005886 6.56% plasma membrane
GO:0005680 6.38% anaphase-promoting complex
GO:0005815 6.29% microtubule organizing center
GO:0072686 6.14% mitotic spindle
GO:0005739 6.09% mitochondrion
GO:0005694 6.08% chromosome
GO:0005783 6.07% endoplasmic reticulum
GO:0031982 6.04% vesicle
GO:0035770 6.02% ribonucleoprotein granule
GO:0005643 5.98% nuclear pore
GO:0008180 5.93% COP9 signalosome
GO:0000124 5.82% SAGA complex
GO:0000307 5.80% cyclin-dependent protein kinase holoenzyme complex
GO:0005732 5.73% small nucleolar ribonucleoprotein complex
GO:0000123 5.72% histone acetyltransferase complex
GO:0009524 5.64% phragmoplast
GO:0005615 5.63% extracellular space
GO:0070461 5.62% SAGA-type complex
GO:0000151 5.60% ubiquitin ligase complex
GO:0042575 5.53% DNA polymerase complex
GO:0031143 5.51% pseudopodium
GO:0008023 5.49% transcription elongation factor complex
GO:0036464 5.40% cytoplasmic ribonucleoprotein granule
GO:0005697 5.40% telomerase holoenzyme complex
GO:0098805 5.37% whole membrane
GO:0098796 5.25% membrane protein complex
GO:0005576 5.24% extracellular region
GO:0032993 5.13% protein-DNA complex
GO:0005773 5.10% vacuole
GO:1905368 5.05% peptidase complex
GO:0098687 4.89% chromosomal region
GO:0000932 4.81% P-body
GO:0097708 4.78% intracellular vesicle
GO:0098588 4.77% bounding membrane of organelle
GO:0031224 4.68% intrinsic component of membrane
GO:0031975 4.67% envelope
GO:0031410 4.62% cytoplasmic vesicle
GO:0099081 4.61% supramolecular polymer
GO:0099512 4.60% supramolecular fiber
GO:0005875 4.58% microtubule associated complex
GO:0031967 4.55% organelle envelope
GO:0034708 4.45% methyltransferase complex
GO:0030054 4.43% cell junction
GO:0042995 4.40% cell projection
GO:0005874 4.40% microtubule
GO:0000775 4.39% chromosome, centromeric region
GO:0016592 4.38% mediator complex
GO:0005840 4.28% ribosome
GO:0016021 4.22% integral component of membrane
GO:0031461 4.19% cullin-RING ubiquitin ligase complex
GO:0098798 4.17% mitochondrial protein complex
GO:0120025 4.15% plasma membrane bounded cell projection
GO:0005813 4.11% centrosome
GO:0099513 4.09% polymeric cytoskeletal fiber
GO:0000793 4.06% condensed chromosome
GO:0098797 4.00% plasma membrane protein complex
GO:0001650 4.00% fibrillar center
GO:0001750 3.92% photoreceptor outer segment
GO:0042579 3.89% microbody
GO:0005794 3.86% Golgi apparatus
GO:0000781 3.79% chromosome, telomeric region
GO:0035861 3.76% site of double-strand break
GO:0048471 3.71% perinuclear region of cytoplasm
GO:0000407 3.70% phagophore assembly site
GO:0030139 3.70% endocytic vesicle
GO:0005635 3.69% nuclear envelope
GO:0000325 3.66% plant-type vacuole
GO:0031012 3.63% extracellular matrix
GO:0034045 3.63% phagophore assembly site membrane
GO:0016469 3.60% proton-transporting two-sector ATPase complex
GO:0098852 3.57% lytic vacuole membrane
GO:0071944 3.57% cell periphery
GO:0046540 3.53% U4/U6 x U5 tri-snRNP complex
GO:0043230 3.51% extracellular organelle
GO:1903561 3.50% extracellular vesicle
GO:0099503 3.50% secretory vesicle
GO:0019867 3.49% outer membrane
GO:0016459 3.47% myosin complex
GO:0070062 3.45% extracellular exosome
GO:0034399 3.44% nuclear periphery
GO:0045275 3.43% respiratory chain complex III
GO:0005777 3.43% peroxisome
GO:0005911 3.43% cell-cell junction
GO:0031966 3.41% mitochondrial membrane
GO:0031968 3.40% organelle outer membrane
GO:0005774 3.40% vacuolar membrane
GO:0097526 3.36% spliceosomal tri-snRNP complex
GO:0010494 3.35% cytoplasmic stress granule
GO:0090734 3.34% site of DNA damage
GO:0000324 3.34% fungal-type vacuole
GO:0000329 3.33% fungal-type vacuole membrane
GO:0000323 3.29% lytic vacuole
GO:0019005 3.27% SCF ubiquitin ligase complex
GO:0000779 3.24% condensed chromosome, centromeric region
GO:0031226 3.22% intrinsic component of plasma membrane
GO:0005640 3.20% nuclear outer membrane
GO:0005816 3.20% spindle pole body
GO:0070938 3.19% contractile ring
GO:0071011 3.19% precatalytic spliceosome
GO:0030286 3.17% dynein complex
GO:0022626 3.13% cytosolic ribosome
GO:0000322 3.11% storage vacuole
GO:0000922 3.11% spindle pole
GO:0031252 3.08% cell leading edge
GO:0044732 3.08% mitotic spindle pole body
GO:0005682 3.07% U5 snRNP
GO:0070847 3.06% core mediator complex
GO:0019866 3.06% organelle inner membrane
GO:0030427 3.01% site of polarized growth
GO:0001917 3.00% photoreceptor inner segment
GO:0005743 2.98% mitochondrial inner membrane
GO:0009536 2.96% plastid
GO:0016604 2.96% nuclear body
GO:0120114 2.95% Sm-like protein family complex
GO:0015030 2.93% Cajal body
GO:0005938 2.91% cell cortex
GO:0015629 2.90% actin cytoskeleton
GO:0030141 2.88% secretory granule
GO:0071005 2.85% U2-type precatalytic spliceosome
GO:0005834 2.84% heterotrimeric G-protein complex
GO:0000153 2.84% cytoplasmic ubiquitin ligase complex
GO:0033178 2.84% proton-transporting two-sector ATPase complex, catalytic domain
GO:1905360 2.82% GTPase complex
GO:0045335 2.81% phagocytic vesicle
GO:0060170 2.78% ciliary membrane
GO:0015935 2.77% small ribosomal subunit
GO:0032153 2.75% cell division site
GO:0031974 2.74% membrane-enclosed lumen
GO:0043332 2.73% mating projection tip
GO:0043233 2.72% organelle lumen
GO:0030684 2.71% preribosome
GO:0070013 2.70% intracellular organelle lumen
GO:0005826 2.68% actomyosin contractile ring
GO:0005685 2.67% U1 snRNP
GO:0099023 2.64% vesicle tethering complex
GO:0005681 2.63% spliceosomal complex
GO:0005935 2.61% cellular bud neck
GO:0016607 2.61% nuclear speck
GO:0005791 2.58% rough endoplasmic reticulum
GO:0000792 2.57% heterochromatin
GO:0005887 2.55% integral component of plasma membrane
GO:0044232 2.53% organelle membrane contact site
GO:0008541 2.53% proteasome regulatory particle, lid subcomplex
GO:0030532 2.53% small nuclear ribonucleoprotein complex
GO:0044391 2.51% ribosomal subunit
GO:0005684 2.49% U2-type spliceosomal complex
GO:0031312 2.47% extrinsic component of organelle membrane
GO:0097525 2.46% spliceosomal snRNP complex
GO:0016363 2.46% nuclear matrix
GO:0000228 2.45% nuclear chromosome
GO:1990204 2.40% oxidoreductase complex
GO:0098800 2.38% inner mitochondrial membrane protein complex
GO:0005814 2.37% centriole
GO:0005789 2.36% endoplasmic reticulum membrane
GO:0000502 2.36% proteasome complex
GO:0045202 2.35% synapse
GO:0071013 2.33% catalytic step 2 spliceosome
GO:0012506 2.32% vesicle membrane
GO:0005686 2.31% U2 snRNP
GO:0031519 2.29% PcG protein complex
GO:0034518 2.27% RNA cap binding complex
GO:0022627 2.26% cytosolic small ribosomal subunit
GO:0030027 2.26% lamellipodium
GO:0045259 2.25% proton-transporting ATP synthase complex
GO:0042788 2.25% polysomal ribosome
GO:0032039 2.24% integrator complex
GO:0009705 2.20% plant-type vacuole membrane
GO:0008287 2.20% protein serine/threonine phosphatase complex
GO:0030136 2.19% clathrin-coated vesicle
GO:0045171 2.19% intercellular bridge
GO:0009507 2.19% chloroplast
GO:0000786 2.18% nucleosome
GO:0009532 2.16% plastid stroma
GO:0030008 2.16% TRAPP complex
GO:0005758 2.16% mitochondrial intermembrane space
GO:0030659 2.16% cytoplasmic vesicle membrane
GO:1990391 2.15% DNA repair complex
GO:0005934 2.15% cellular bud tip
GO:0033176 2.14% proton-transporting V-type ATPase complex
GO:0005765 2.14% lysosomal membrane
GO:0009570 2.13% chloroplast stroma
GO:1903293 2.12% phosphatase complex
GO:0005759 2.11% mitochondrial matrix
GO:0090568 2.10% nuclear transcriptional repressor complex
GO:0005753 2.09% mitochondrial proton-transporting ATP synthase complex
GO:1905369 2.08% endopeptidase complex
GO:0005741 2.05% mitochondrial outer membrane
GO:0043292 2.05% contractile fiber
GO:0009295 2.05% nucleoid
GO:0005764 2.04% lysosome
GO:0019898 2.03% extrinsic component of membrane
GO:0017119 2.01% Golgi transport complex
GO:0080008 1.98% Cul4-RING E3 ubiquitin ligase complex
GO:0005793 1.98% endoplasmic reticulum-Golgi intermediate compartment
GO:0043186 1.97% P granule
GO:0043005 1.97% neuron projection
GO:0005689 1.97% U12-type spliceosomal complex
GO:0044815 1.96% DNA packaging complex
GO:0035267 1.96% NuA4 histone acetyltransferase complex
GO:0031970 1.95% organelle envelope lumen
GO:0071010 1.94% prespliceosome
GO:0032040 1.91% small-subunit processome
GO:0097431 1.90% mitotic spindle pole
GO:0030135 1.90% coated vesicle
GO:0009506 1.90% plasmodesma
GO:0071004 1.89% U2-type prespliceosome
GO:0005929 1.88% cilium
GO:0051286 1.87% cell tip
GO:0005770 1.86% late endosome
GO:0032592 1.86% integral component of mitochondrial membrane
GO:0005942 1.85% phosphatidylinositol 3-kinase complex
GO:0045261 1.84% proton-transporting ATP synthase complex, catalytic core F(1)
GO:0016324 1.83% apical plasma membrane
GO:0000139 1.82% Golgi membrane
GO:0005811 1.81% lipid droplet
GO:0098590 1.80% plasma membrane region
GO:0005868 1.80% cytoplasmic dynein complex
GO:0043189 1.79% H4/H2A histone acetyltransferase complex
GO:0070069 1.78% cytochrome complex
GO:0033290 1.78% eukaryotic 48S preinitiation complex
GO:0030479 1.76% actin cortical patch
GO:0005763 1.75% mitochondrial small ribosomal subunit
GO:0000315 1.75% organellar large ribosomal subunit
GO:0061645 1.74% endocytic patch
GO:0099738 1.73% cell cortex region
GO:0030687 1.72% preribosome, large subunit precursor
GO:0001669 1.72% acrosomal vesicle
GO:0005700 1.71% polytene chromosome
GO:0005721 1.71% pericentric heterochromatin
GO:1990351 1.71% transporter complex
GO:0005768 1.71% endosome
GO:0000943 1.69% retrotransposon nucleocapsid
GO:0043596 1.69% nuclear replication fork
GO:0051233 1.69% spindle midzone
GO:0000314 1.69% organellar small ribosomal subunit
GO:0033180 1.67% proton-transporting V-type ATPase, V1 domain
GO:0000794 1.65% condensed nuclear chromosome
GO:0031253 1.64% cell projection membrane
GO:0000118 1.63% histone deacetylase complex
GO:0031314 1.62% extrinsic component of mitochondrial inner membrane
GO:0070993 1.59% translation preinitiation complex
GO:0098573 1.58% intrinsic component of mitochondrial membrane
GO:0098791 1.57% Golgi subcompartment
GO:0016328 1.55% lateral plasma membrane
GO:0099568 1.54% cytoplasmic region
GO:0005762 1.54% mitochondrial large ribosomal subunit
GO:0036064 1.54% ciliary basal body
GO:0098978 1.53% glutamatergic synapse
GO:0016234 1.53% inclusion body
GO:0030667 1.52% secretory granule membrane
GO:0030428 1.50% cell septum
GO:0097730 1.50% non-motile cilium
GO:0010008 1.49% endosome membrane
GO:0031301 1.49% integral component of organelle membrane
GO:0031462 1.49% Cul2-RING ubiquitin ligase complex
GO:0030425 1.48% dendrite
GO:0031984 1.48% organelle subcompartment
GO:0031261 1.48% DNA replication preinitiation complex
GO:0043195 1.46% terminal bouton
GO:1902562 1.46% H4 histone acetyltransferase complex
GO:0031463 1.46% Cul3-RING ubiquitin ligase complex
GO:0005876 1.44% spindle microtubule
GO:0030119 1.43% AP-type membrane coat adaptor complex
GO:0030131 1.43% clathrin adaptor complex
GO:0005628 1.43% prospore membrane
GO:0031305 1.41% integral component of mitochondrial inner membrane
GO:0032982 1.41% myosin filament
GO:0071007 1.41% U2-type catalytic step 2 spliceosome
GO:0000178 1.41% exosome (RNase complex)
GO:1905354 1.40% exoribonuclease complex
GO:0031300 1.40% intrinsic component of organelle membrane
GO:0030016 1.40% myofibril
GO:0042641 1.39% actomyosin
GO:0071014 1.38% post-mRNA release spliceosomal complex
GO:0000109 1.37% nucleotide-excision repair complex
GO:1904949 1.37% ATPase complex
GO:0098799 1.36% outer mitochondrial membrane protein complex
GO:0016282 1.36% eukaryotic 43S preinitiation complex
GO:0015630 1.34% microtubule cytoskeleton
GO:0097546 1.34% ciliary base
GO:0031903 1.33% microbody membrane
GO:0101031 1.33% chaperone complex
GO:0043235 1.31% receptor complex
GO:0005779 1.30% integral component of peroxisomal membrane
GO:0015934 1.30% large ribosomal subunit
GO:0098636 1.30% protein complex involved in cell adhesion
GO:0035097 1.29% histone methyltransferase complex
GO:0005657 1.28% replication fork
GO:0009941 1.28% chloroplast envelope
GO:0031082 1.28% BLOC complex
GO:0031231 1.25% intrinsic component of peroxisomal membrane
GO:0012505 1.25% endomembrane system
GO:0005778 1.25% peroxisomal membrane
GO:0030496 1.25% midbody
GO:0005637 1.25% nuclear inner membrane
GO:0032432 1.25% actin filament bundle
GO:0031304 1.24% intrinsic component of mitochondrial inner membrane
GO:0009526 1.24% plastid envelope
GO:0035579 1.24% specific granule membrane
GO:0005801 1.23% cis-Golgi network
GO:0030424 1.22% axon
GO:0031514 1.21% motile cilium
GO:0005788 1.21% endoplasmic reticulum lumen
GO:0030688 1.21% preribosome, small subunit precursor
GO:0098803 1.20% respiratory chain complex
GO:0005802 1.19% trans-Golgi network
GO:0008250 1.17% oligosaccharyltransferase complex
GO:0048046 1.16% apoplast
GO:0042597 1.15% periplasmic space
GO:0033202 1.15% DNA helicase complex
GO:0000145 1.14% exocyst
GO:0031228 1.14% intrinsic component of Golgi membrane
GO:0070821 1.14% tertiary granule membrane
GO:0098794 1.14% postsynapse
GO:0030118 1.14% clathrin coat
GO:0022625 1.10% cytosolic large ribosomal subunit
GO:0019774 1.10% proteasome core complex, beta-subunit complex
GO:1990023 1.10% mitotic spindle midzone
GO:0000812 1.09% Swr1 complex
GO:0060205 1.07% cytoplasmic vesicle lumen
GO:0097228 1.06% sperm principal piece
GO:0045177 1.06% apical part of cell
GO:0000177 1.06% cytoplasmic exosome (RNase complex)
GO:0009986 1.05% cell surface
GO:0098793 1.05% presynapse
GO:0009897 1.03% external side of plasma membrane
GO:1904813 1.03% ficolin-1-rich granule lumen
GO:0033177 1.03% proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0018995 1.02% host cellular component
GO:0005795 1.02% Golgi stack
GO:0031983 1.01% vesicle lumen
Back
Download
TOP