TOP
UniProt ID:
P81180
Entry Name:
CVN_NOSEL
Sequence:
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
Molecular Function
Biological Process
Cellular Component
Score (%) 7.43~17.56
GO Terms Score Description
GO:0008150 17.56% biological_process
GO:0009987 12.32% cellular process
GO:0065007 10.83% biological regulation
GO:0050896 10.74% response to stimulus
GO:0006950 10.60% response to stress
GO:0006810 10.43% transport
GO:0051234 10.05% establishment of localization
GO:0051179 9.81% localization
GO:0008152 9.45% metabolic process
GO:0050789 9.12% regulation of biological process
GO:0051704 9.04% multi-organism process
GO:0044237 8.63% cellular metabolic process
GO:0071702 8.50% organic substance transport
GO:0006811 8.39% ion transport
GO:0042221 8.38% response to chemical
GO:0033554 8.36% cellular response to stress
GO:0050794 8.36% regulation of cellular process
GO:0051716 8.33% cellular response to stimulus
GO:0065008 8.24% regulation of biological quality
GO:0009628 8.15% response to abiotic stimulus
GO:0006952 7.91% defense response
GO:0071704 7.54% organic substance metabolic process
GO:0055085 7.54% transmembrane transport
GO:0042592 7.44% homeostatic process
GO:0051703 7.43% intraspecies interaction between organisms
GO:0044238 7.22% primary metabolic process
GO:0061077 7.20% chaperone-mediated protein folding
GO:0051707 6.98% response to other organism
GO:0006974 6.82% cellular response to DNA damage stimulus
GO:0010035 6.80% response to inorganic substance
GO:0070887 6.62% cellular response to chemical stimulus
GO:0043207 6.52% response to external biotic stimulus
GO:0006457 6.46% protein folding
GO:0006869 6.45% lipid transport
GO:0019222 6.42% regulation of metabolic process
GO:0071840 6.42% cellular component organization or biogenesis
GO:0006955 6.32% immune response
GO:0008643 6.31% carbohydrate transport
GO:0009607 6.29% response to biotic stimulus
GO:0044764 6.22% multi-organism cellular process
GO:0016043 6.19% cellular component organization
GO:0099120 6.19% socially cooperative development
GO:0032502 6.17% developmental process
GO:0006807 6.15% nitrogen compound metabolic process
GO:0034220 6.07% ion transmembrane transport
GO:0032501 6.06% multicellular organismal process
GO:0043170 6.06% macromolecule metabolic process
GO:0009605 6.05% response to external stimulus
GO:0098542 5.93% defense response to other organism
GO:0006091 5.92% generation of precursor metabolites and energy
GO:0002376 5.91% immune system process
GO:0009266 5.90% response to temperature stimulus
GO:0050790 5.90% regulation of catalytic activity
GO:0009401 5.87% phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0009314 5.83% response to radiation
GO:0104004 5.80% cellular response to environmental stimulus
GO:0071214 5.76% cellular response to abiotic stimulus
GO:0044281 5.73% small molecule metabolic process
GO:0022607 5.71% cellular component assembly
GO:0006979 5.62% response to oxidative stress
GO:0048856 5.60% anatomical structure development
GO:0034599 5.59% cellular response to oxidative stress
GO:1901564 5.56% organonitrogen compound metabolic process
GO:0071705 5.54% nitrogen compound transport
GO:0007154 5.54% cell communication
GO:0031323 5.54% regulation of cellular metabolic process
GO:0007165 5.53% signal transduction
GO:0043933 5.48% protein-containing complex subunit organization
GO:0009617 5.46% response to bacterium
GO:0072593 5.41% reactive oxygen species metabolic process
GO:0006812 5.40% cation transport
GO:0065003 5.32% protein-containing complex assembly
GO:0019725 5.29% cellular homeostasis
GO:0006820 5.28% anion transport
GO:0006793 5.23% phosphorus metabolic process
GO:0006796 5.23% phosphate-containing compound metabolic process
GO:0006970 5.22% response to osmotic stress
GO:1901360 5.20% organic cyclic compound metabolic process
GO:0009058 5.20% biosynthetic process
GO:0010033 5.17% response to organic substance
GO:1901700 5.16% response to oxygen-containing compound
GO:0055114 5.12% oxidation-reduction process
GO:0009056 5.08% catabolic process
GO:0065009 5.07% regulation of molecular function
GO:0032787 5.03% monocarboxylic acid metabolic process
GO:0010038 5.03% response to metal ion
GO:0019538 5.02% protein metabolic process
GO:0051604 5.02% protein maturation
GO:0042886 5.01% amide transport
GO:0051084 5.00% 'de novo' posttranslational protein folding
GO:0048519 4.97% negative regulation of biological process
GO:0015833 4.97% peptide transport
GO:0048878 4.96% chemical homeostasis
GO:0044260 4.95% cellular macromolecule metabolic process
GO:0009416 4.92% response to light stimulus
GO:0003008 4.89% system process
GO:0015031 4.87% protein transport
GO:0006825 4.87% copper ion transport
GO:0008104 4.83% protein localization
GO:0009408 4.83% response to heat
GO:0071806 4.82% protein transmembrane transport
GO:0048518 4.80% positive regulation of biological process
GO:0043085 4.78% positive regulation of catalytic activity
GO:0045333 4.78% cellular respiration
GO:0046677 4.76% response to antibiotic
GO:0033036 4.76% macromolecule localization
GO:0071496 4.76% cellular response to external stimulus
GO:0046907 4.76% intracellular transport
GO:0006629 4.74% lipid metabolic process
GO:0044249 4.72% cellular biosynthetic process
GO:0045184 4.71% establishment of protein localization
GO:0045087 4.69% innate immune response
GO:0044093 4.69% positive regulation of molecular function
GO:0080090 4.67% regulation of primary metabolic process
GO:0030001 4.66% metal ion transport
GO:1901575 4.61% organic substance catabolic process
GO:0044248 4.55% cellular catabolic process
GO:0048523 4.55% negative regulation of cellular process
GO:0050821 4.53% protein stabilization
GO:0031647 4.51% regulation of protein stability
GO:0051641 4.49% cellular localization
GO:0060255 4.48% regulation of macromolecule metabolic process
GO:0006458 4.47% 'de novo' protein folding
GO:0001101 4.45% response to acid chemical
GO:0006725 4.44% cellular aromatic compound metabolic process
GO:0098754 4.44% detoxification
GO:0022414 4.43% reproductive process
GO:0031668 4.42% cellular response to extracellular stimulus
GO:0022610 4.40% biological adhesion
GO:0051259 4.37% protein complex oligomerization
GO:0045454 4.36% cell redox homeostasis
GO:0019752 4.33% carboxylic acid metabolic process
GO:0009644 4.33% response to high light intensity
GO:0006886 4.31% intracellular protein transport
GO:0015711 4.30% organic anion transport
GO:0034622 4.29% cellular protein-containing complex assembly
GO:0034641 4.28% cellular nitrogen compound metabolic process
GO:0031163 4.25% metallo-sulfur cluster assembly
GO:0000302 4.24% response to reactive oxygen species
GO:0046483 4.23% heterocycle metabolic process
GO:0070727 4.23% cellular macromolecule localization
GO:1901576 4.21% organic substance biosynthetic process
GO:0043436 4.19% oxoacid metabolic process
GO:0016226 4.18% iron-sulfur cluster assembly
GO:0000003 4.18% reproduction
GO:0016192 4.17% vesicle-mediated transport
GO:0007155 4.16% cell adhesion
GO:0034613 4.16% cellular protein localization
GO:0006082 4.14% organic acid metabolic process
GO:0034614 4.13% cellular response to reactive oxygen species
GO:0048583 4.12% regulation of response to stimulus
GO:0034605 4.07% cellular response to heat
GO:0048522 4.04% positive regulation of cellular process
GO:0009620 4.03% response to fungus
GO:0098657 4.02% import into cell
GO:0015672 4.02% monovalent inorganic cation transport
GO:1901135 4.01% carbohydrate derivative metabolic process
GO:0009411 4.01% response to UV
GO:0071236 4.01% cellular response to antibiotic
GO:0043462 4.00% regulation of ATPase activity
GO:0006839 3.99% mitochondrial transport
GO:0015979 3.98% photosynthesis
GO:0051186 3.98% cofactor metabolic process
GO:0051188 3.98% cofactor biosynthetic process
GO:1901264 3.97% carbohydrate derivative transport
GO:0016310 3.97% phosphorylation
GO:0006996 3.97% organelle organization
GO:0051171 3.97% regulation of nitrogen compound metabolic process
GO:0006897 3.97% endocytosis
GO:0009409 3.96% response to cold
GO:0044267 3.96% cellular protein metabolic process
GO:0071478 3.95% cellular response to radiation
GO:0000041 3.95% transition metal ion transport
GO:0006139 3.95% nucleobase-containing compound metabolic process
GO:0031669 3.94% cellular response to nutrient levels
GO:0010941 3.93% regulation of cell death
GO:0043412 3.93% macromolecule modification
GO:0034644 3.93% cellular response to UV
GO:0048869 3.93% cellular developmental process
GO:1990542 3.92% mitochondrial transmembrane transport
GO:0072594 3.90% establishment of protein localization to organelle
GO:0046034 3.90% ATP metabolic process
GO:0035556 3.90% intracellular signal transduction
GO:0044255 3.90% cellular lipid metabolic process
GO:0009060 3.89% aerobic respiration
GO:1990748 3.84% cellular detoxification
GO:0098660 3.80% inorganic ion transmembrane transport
GO:0015980 3.80% energy derivation by oxidation of organic compounds
GO:0060548 3.80% negative regulation of cell death
GO:0043067 3.79% regulation of programmed cell death
GO:0008219 3.79% cell death
GO:0022900 3.78% electron transport chain
GO:0050832 3.78% defense response to fungus
GO:0090407 3.77% organophosphate biosynthetic process
GO:0009991 3.76% response to extracellular stimulus
GO:0009642 3.75% response to light intensity
GO:0012501 3.75% programmed cell death
GO:0061024 3.74% membrane organization
GO:0042742 3.72% defense response to bacterium
GO:0098655 3.72% cation transmembrane transport
GO:0051085 3.72% chaperone cofactor-dependent protein refolding
GO:0046942 3.71% carboxylic acid transport
GO:0098630 3.70% aggregation of unicellular organisms
GO:0006878 3.70% cellular copper ion homeostasis
GO:0043069 3.70% negative regulation of programmed cell death
GO:0055070 3.69% copper ion homeostasis
GO:0015918 3.69% sterol transport
GO:0015850 3.69% organic hydroxy compound transport
GO:0015849 3.68% organic acid transport
GO:0006631 3.68% fatty acid metabolic process
GO:0023051 3.68% regulation of signaling
GO:0071482 3.67% cellular response to light stimulus
GO:0033365 3.67% protein localization to organelle
GO:0009893 3.67% positive regulation of metabolic process
GO:0030435 3.67% sporulation resulting in formation of a cellular spore
GO:0090702 3.66% non-reproductive fruiting body development
GO:0010646 3.65% regulation of cell communication
GO:0010447 3.64% response to acidic pH
GO:0019637 3.64% organophosphate metabolic process
GO:0042493 3.63% response to drug
GO:0030587 3.61% sorocarp development
GO:0055076 3.61% transition metal ion homeostasis
GO:0046916 3.61% cellular transition metal ion homeostasis
GO:0030154 3.61% cell differentiation
GO:0043086 3.59% negative regulation of catalytic activity
GO:0098743 3.59% cell aggregation
GO:0098869 3.58% cellular oxidant detoxification
GO:0006464 3.57% cellular protein modification process
GO:0019216 3.56% regulation of lipid metabolic process
GO:0008630 3.56% intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009414 3.55% response to water deprivation
GO:0050877 3.55% nervous system process
GO:0005975 3.55% carbohydrate metabolic process
GO:0014070 3.54% response to organic cyclic compound
GO:0051049 3.54% regulation of transport
GO:1901701 3.54% cellular response to oxygen-containing compound
GO:0017038 3.54% protein import
GO:0036211 3.53% protein modification process
GO:0090304 3.51% nucleic acid metabolic process
GO:0043066 3.51% negative regulation of apoptotic process
GO:1901566 3.51% organonitrogen compound biosynthetic process
GO:0006928 3.50% movement of cell or subcellular component
GO:0001505 3.50% regulation of neurotransmitter levels
GO:0098771 3.48% inorganic ion homeostasis
GO:0032879 3.48% regulation of localization
GO:0050801 3.48% ion homeostasis
GO:0008610 3.47% lipid biosynthetic process
GO:0097428 3.47% protein maturation by iron-sulfur cluster transfer
GO:0044403 3.47% symbiotic process
GO:0048646 3.46% anatomical structure formation involved in morphogenesis
GO:0042981 3.46% regulation of apoptotic process
GO:0016054 3.45% organic acid catabolic process
GO:0046903 3.45% secretion
GO:0007267 3.45% cell-cell signaling
GO:0007610 3.44% behavior
GO:0006605 3.44% protein targeting
GO:0071453 3.43% cellular response to oxygen levels
GO:0009651 3.43% response to salt stress
GO:0070482 3.43% response to oxygen levels
GO:0033108 3.42% mitochondrial respiratory chain complex assembly
GO:0009892 3.42% negative regulation of metabolic process
GO:0022904 3.41% respiratory electron transport chain
GO:0097435 3.41% supramolecular fiber organization
GO:0044419 3.40% interspecies interaction between organisms
GO:0009966 3.40% regulation of signal transduction
GO:0051336 3.40% regulation of hydrolase activity
GO:0098662 3.39% inorganic cation transmembrane transport
GO:1901362 3.39% organic cyclic compound biosynthetic process
GO:0033993 3.38% response to lipid
GO:0042542 3.38% response to hydrogen peroxide
GO:0042737 3.38% drug catabolic process
GO:0009267 3.37% cellular response to starvation
GO:0006119 3.36% oxidative phosphorylation
GO:1901565 3.36% organonitrogen compound catabolic process
GO:0009636 3.36% response to toxic substance
GO:0018904 3.35% ether metabolic process
GO:0031667 3.35% response to nutrient levels
GO:0071103 3.35% DNA conformation change
GO:0055080 3.34% cation homeostasis
GO:0006873 3.34% cellular ion homeostasis
GO:0044282 3.34% small molecule catabolic process
GO:0017144 3.34% drug metabolic process
GO:0007015 3.33% actin filament organization
GO:0140352 3.33% export from cell
GO:0055082 3.33% cellular chemical homeostasis
GO:0065002 3.33% intracellular protein transmembrane transport
GO:0055065 3.33% metal ion homeostasis
GO:0009719 3.32% response to endogenous stimulus
GO:0046395 3.31% carboxylic acid catabolic process
GO:0042594 3.30% response to starvation
GO:0009889 3.30% regulation of biosynthetic process
GO:0032940 3.29% secretion by cell
GO:0071468 3.29% cellular response to acidic pH
GO:0023052 3.26% signaling
GO:0010468 3.25% regulation of gene expression
GO:0010565 3.23% regulation of cellular ketone metabolic process
GO:0022402 3.23% cell cycle process
GO:0009988 3.23% cell-cell recognition
GO:0040011 3.22% locomotion
GO:0006875 3.22% cellular metal ion homeostasis
GO:0003006 3.22% developmental process involved in reproduction
GO:0019954 3.21% asexual reproduction
GO:0030003 3.18% cellular cation homeostasis
GO:0006826 3.18% iron ion transport
GO:0006662 3.18% glycerol ether metabolic process
GO:0071241 3.18% cellular response to inorganic substance
GO:0007005 3.16% mitochondrion organization
GO:0051128 3.15% regulation of cellular component organization
GO:0048584 3.14% positive regulation of response to stimulus
GO:0006879 3.12% cellular iron ion homeostasis
GO:0043934 3.11% sporulation
GO:0070301 3.10% cellular response to hydrogen peroxide
GO:0043900 3.10% regulation of multi-organism process
GO:0007600 3.10% sensory perception
GO:0031326 3.10% regulation of cellular biosynthetic process
GO:0009653 3.09% anatomical structure morphogenesis
GO:1901615 3.09% organic hydroxy compound metabolic process
GO:0097193 3.08% intrinsic apoptotic signaling pathway
GO:0071470 3.08% cellular response to osmotic stress
GO:0009415 3.07% response to water
GO:0035690 3.07% cellular response to drug
GO:0031324 3.06% negative regulation of cellular metabolic process
GO:0009615 3.05% response to virus
GO:0062012 3.04% regulation of small molecule metabolic process
GO:0044092 3.03% negative regulation of molecular function
GO:0055072 3.03% iron ion homeostasis
GO:0032781 3.03% positive regulation of ATPase activity
GO:0042133 3.02% neurotransmitter metabolic process
GO:0044271 3.02% cellular nitrogen compound biosynthetic process
GO:1902600 3.02% proton transmembrane transport
GO:0031325 3.01% positive regulation of cellular metabolic process
GO:0097237 3.01% cellular response to toxic substance
GO:0042127 3.00% regulation of cell population proliferation
GO:0098656 3.00% anion transmembrane transport
GO:0048513 2.99% animal organ development
GO:0032365 2.99% intracellular lipid transport
GO:0031152 2.99% aggregation involved in sorocarp development
GO:0019430 2.99% removal of superoxide radicals
GO:0009268 2.98% response to pH
GO:0022411 2.98% cellular component disassembly
GO:0008340 2.97% determination of adult lifespan
GO:0007268 2.97% chemical synaptic transmission
GO:0042135 2.97% neurotransmitter catabolic process
GO:0019219 2.97% regulation of nucleobase-containing compound metabolic process
GO:0016032 2.97% viral process
GO:0051239 2.97% regulation of multicellular organismal process
GO:1901361 2.96% organic cyclic compound catabolic process
GO:0006801 2.96% superoxide metabolic process
GO:0007608 2.96% sensory perception of smell
GO:0006972 2.95% hyperosmotic response
GO:0006508 2.94% proteolysis
GO:0009725 2.92% response to hormone
GO:0098916 2.92% anterograde trans-synaptic signaling
GO:0010224 2.92% response to UV-B
GO:0031329 2.91% regulation of cellular catabolic process
GO:0051353 2.90% positive regulation of oxidoreductase activity
GO:0036293 2.90% response to decreased oxygen levels
GO:0016070 2.90% RNA metabolic process
GO:0009059 2.90% macromolecule biosynthetic process
GO:0017001 2.87% antibiotic catabolic process
GO:0018130 2.86% heterocycle biosynthetic process
GO:0019439 2.86% aromatic compound catabolic process
GO:0007635 2.85% chemosensory behavior
GO:0001666 2.85% response to hypoxia
GO:0055086 2.85% nucleobase-containing small molecule metabolic process
GO:0071456 2.84% cellular response to hypoxia
GO:0035036 2.84% sperm-egg recognition
GO:0034204 2.83% lipid translocation
GO:0008154 2.83% actin polymerization or depolymerization
GO:0070972 2.83% protein localization to endoplasmic reticulum
GO:0048870 2.83% cell motility
GO:0007275 2.82% multicellular organism development
GO:1901654 2.82% response to ketone
GO:0006915 2.82% apoptotic process
GO:0044270 2.81% cellular nitrogen compound catabolic process
GO:0034645 2.81% cellular macromolecule biosynthetic process
GO:0051246 2.81% regulation of protein metabolic process
GO:0006122 2.80% mitochondrial electron transport, ubiquinol to cytochrome c
GO:0072657 2.80% protein localization to membrane
GO:0015914 2.80% phospholipid transport
GO:0051260 2.80% protein homooligomerization
GO:0006790 2.80% sulfur compound metabolic process
GO:0002250 2.80% adaptive immune response
GO:0015718 2.79% monocarboxylic acid transport
GO:0043269 2.78% regulation of ion transport
GO:0051187 2.77% cofactor catabolic process
GO:0090150 2.77% establishment of protein localization to membrane
GO:0015748 2.76% organophosphate ester transport
GO:0006259 2.76% DNA metabolic process
GO:0072329 2.75% monocarboxylic acid catabolic process
GO:0032268 2.74% regulation of cellular protein metabolic process
GO:0019438 2.74% aromatic compound biosynthetic process
GO:0007186 2.74% G protein-coupled receptor signaling pathway
GO:0097164 2.74% ammonium ion metabolic process
GO:0072599 2.74% establishment of protein localization to endoplasmic reticulum
GO:0099537 2.73% trans-synaptic signaling
GO:0072330 2.73% monocarboxylic acid biosynthetic process
GO:0009117 2.73% nucleotide metabolic process
GO:0015698 2.73% inorganic anion transport
GO:0080134 2.73% regulation of response to stress
GO:0036294 2.73% cellular response to decreased oxygen levels
GO:0036296 2.72% response to increased oxygen levels
GO:1901678 2.72% iron coordination entity transport
GO:0060249 2.72% anatomical structure homeostasis
GO:0009894 2.70% regulation of catabolic process
GO:0031589 2.69% cell-substrate adhesion
GO:0044743 2.69% protein transmembrane import into intracellular organelle
GO:0006396 2.69% RNA processing
GO:0043467 2.69% regulation of generation of precursor metabolites and energy
GO:0060341 2.69% regulation of cellular localization
GO:0034285 2.68% response to disaccharide
GO:0071310 2.68% cellular response to organic substance
GO:0046700 2.68% heterocycle catabolic process
GO:0071248 2.68% cellular response to metal ion
GO:0051235 2.67% maintenance of location
GO:1901137 2.67% carbohydrate derivative biosynthetic process
GO:0006986 2.67% response to unfolded protein
GO:0051262 2.66% protein tetramerization
GO:1903827 2.66% regulation of cellular protein localization
GO:0097305 2.66% response to alcohol
GO:0031288 2.65% sorocarp morphogenesis
GO:0009888 2.65% tissue development
GO:0006753 2.64% nucleoside phosphate metabolic process
GO:0009744 2.63% response to sucrose
GO:0099536 2.63% synaptic signaling
GO:0097190 2.63% apoptotic signaling pathway
GO:0019722 2.62% calcium-mediated signaling
GO:0009057 2.62% macromolecule catabolic process
GO:0051651 2.62% maintenance of location in cell
GO:0007606 2.62% sensory perception of chemical stimulus
GO:1901293 2.61% nucleoside phosphate biosynthetic process
GO:1903725 2.61% regulation of phospholipid metabolic process
GO:0022600 2.60% digestive system process
GO:0007049 2.60% cell cycle
GO:0006954 2.60% inflammatory response
GO:0009165 2.59% nucleotide biosynthetic process
GO:0051341 2.59% regulation of oxidoreductase activity
GO:0051347 2.59% positive regulation of transferase activity
GO:0019220 2.59% regulation of phosphate metabolic process
GO:0010506 2.59% regulation of autophagy
GO:0051174 2.59% regulation of phosphorus metabolic process
GO:0042744 2.59% hydrogen peroxide catabolic process
GO:0042048 2.58% olfactory behavior
GO:0001894 2.57% tissue homeostasis
GO:0002790 2.57% peptide secretion
GO:0048364 2.56% root development
GO:0006099 2.56% tricarboxylic acid cycle
GO:0016052 2.55% carbohydrate catabolic process
GO:0006633 2.54% fatty acid biosynthetic process
GO:1901606 2.54% alpha-amino acid catabolic process
GO:0080135 2.54% regulation of cellular response to stress
GO:0016999 2.53% antibiotic metabolic process
GO:0045332 2.53% phospholipid translocation
GO:0030097 2.53% hemopoiesis
GO:0034976 2.52% response to endoplasmic reticulum stress
GO:0051346 2.52% negative regulation of hydrolase activity
GO:0046890 2.51% regulation of lipid biosynthetic process
GO:0009611 2.51% response to wounding
GO:0072665 2.51% protein localization to vacuole
GO:0019318 2.49% hexose metabolic process
GO:0043562 2.49% cellular response to nitrogen levels
GO:1903506 2.48% regulation of nucleic acid-templated transcription
GO:0007009 2.48% plasma membrane organization
GO:0019217 2.48% regulation of fatty acid metabolic process
GO:0010556 2.48% regulation of macromolecule biosynthetic process
GO:1902531 2.48% regulation of intracellular signal transduction
GO:0009063 2.48% cellular amino acid catabolic process
GO:0051345 2.48% positive regulation of hydrolase activity
GO:0019730 2.48% antimicrobial humoral response
GO:2000112 2.47% regulation of cellular macromolecule biosynthetic process
GO:0006355 2.47% regulation of transcription, DNA-templated
GO:0001539 2.46% cilium or flagellum-dependent cell motility
GO:0046688 2.46% response to copper ion
GO:0051338 2.46% regulation of transferase activity
GO:0006612 2.46% protein targeting to membrane
GO:0006959 2.46% humoral immune response
GO:0042440 2.46% pigment metabolic process
GO:0048534 2.45% hematopoietic or lymphoid organ development
GO:0043603 2.45% cellular amide metabolic process
GO:0051252 2.44% regulation of RNA metabolic process
GO:2001141 2.43% regulation of RNA biosynthetic process
GO:0035966 2.43% response to topologically incorrect protein
GO:0006066 2.42% alcohol metabolic process
GO:0034765 2.42% regulation of ion transmembrane transport
GO:0045047 2.42% protein targeting to ER
GO:0009737 2.41% response to abscisic acid
GO:0006898 2.41% receptor-mediated endocytosis
GO:0048609 2.41% multicellular organismal reproductive process
GO:0000746 2.40% conjugation
GO:0010039 2.40% response to iron ion
GO:0032446 2.40% protein modification by small protein conjugation
GO:0023056 2.40% positive regulation of signaling
GO:0022898 2.39% regulation of transmembrane transporter activity
GO:0044087 2.39% regulation of cellular component biogenesis
GO:0000910 2.39% cytokinesis
GO:0051276 2.39% chromosome organization
GO:0006399 2.39% tRNA metabolic process
GO:0050793 2.39% regulation of developmental process
GO:0007339 2.39% binding of sperm to zona pellucida
GO:0019646 2.39% aerobic electron transport chain
GO:0005996 2.39% monosaccharide metabolic process
GO:0034762 2.39% regulation of transmembrane transport
GO:0071467 2.38% cellular response to pH
GO:0051258 2.38% protein polymerization
GO:0032981 2.38% mitochondrial respiratory chain complex I assembly
GO:0032412 2.37% regulation of ion transmembrane transporter activity
GO:0008361 2.37% regulation of cell size
GO:0070647 2.37% protein modification by small protein conjugation or removal
GO:0010257 2.37% NADH dehydrogenase complex assembly
GO:0006281 2.37% DNA repair
GO:0008284 2.37% positive regulation of cell population proliferation
GO:0046685 2.37% response to arsenic-containing substance
GO:0048585 2.37% negative regulation of response to stimulus
GO:0006006 2.36% glucose metabolic process
GO:0019731 2.36% antibacterial humoral response
GO:0042335 2.35% cuticle development
GO:0042391 2.35% regulation of membrane potential
GO:1901698 2.35% response to nitrogen compound
GO:0051050 2.35% positive regulation of transport
GO:0071709 2.35% membrane assembly
GO:0010604 2.35% positive regulation of macromolecule metabolic process
GO:0050829 2.34% defense response to Gram-negative bacterium
GO:0043254 2.34% regulation of protein complex assembly
GO:0006909 2.34% phagocytosis
GO:0071229 2.34% cellular response to acid chemical
GO:1903829 2.34% positive regulation of cellular protein localization
GO:0010647 2.34% positive regulation of cell communication
GO:0016053 2.33% organic acid biosynthetic process
GO:0016311 2.33% dephosphorylation
GO:0043457 2.33% regulation of cellular respiration
GO:0030091 2.32% protein repair
GO:0022412 2.31% cellular process involved in reproduction in multicellular organism
GO:0035592 2.31% establishment of protein localization to extracellular region
GO:0007010 2.31% cytoskeleton organization
GO:0010817 2.31% regulation of hormone levels
GO:0015908 2.31% fatty acid transport
GO:0016485 2.30% protein processing
GO:0042743 2.29% hydrogen peroxide metabolic process
GO:0033043 2.29% regulation of organelle organization
GO:0051131 2.28% chaperone-mediated protein complex assembly
GO:0034654 2.28% nucleobase-containing compound biosynthetic process
GO:0071692 2.28% protein localization to extracellular region
GO:0071472 2.27% cellular response to salt stress
GO:0006739 2.27% NADP metabolic process
GO:0017004 2.27% cytochrome complex assembly
GO:0033157 2.27% regulation of intracellular protein transport
GO:0044265 2.26% cellular macromolecule catabolic process
GO:0009306 2.26% protein secretion
GO:0042773 2.25% ATP synthesis coupled electron transport
GO:0051592 2.25% response to calcium ion
GO:0006109 2.25% regulation of carbohydrate metabolic process
GO:0042254 2.25% ribosome biogenesis
GO:0006520 2.25% cellular amino acid metabolic process
GO:0032984 2.23% protein-containing complex disassembly
GO:0030258 2.23% lipid modification
GO:0051180 2.23% vitamin transport
GO:0006123 2.23% mitochondrial electron transport, cytochrome c to oxygen
GO:0008283 2.23% cell population proliferation
GO:0043270 2.23% positive regulation of ion transport
GO:0034050 2.22% host programmed cell death induced by symbiont
GO:0007166 2.22% cell surface receptor signaling pathway
GO:0008202 2.21% steroid metabolic process
GO:0019932 2.21% second-messenger-mediated signaling
GO:0034308 2.21% primary alcohol metabolic process
GO:0030301 2.21% cholesterol transport
GO:0033344 2.19% cholesterol efflux
GO:0042325 2.19% regulation of phosphorylation
GO:0010959 2.19% regulation of metal ion transport
GO:0048731 2.18% system development
GO:0009260 2.18% ribonucleotide biosynthetic process
GO:0016236 2.18% macroautophagy
GO:0010669 2.18% epithelial structure maintenance
GO:0062014 2.17% negative regulation of small molecule metabolic process
GO:0007218 2.17% neuropeptide signaling pathway
GO:0032386 2.17% regulation of intracellular transport
GO:0070206 2.17% protein trimerization
GO:0030041 2.17% actin filament polymerization
GO:0046394 2.16% carboxylic acid biosynthetic process
GO:1902652 2.16% secondary alcohol metabolic process
GO:0032409 2.16% regulation of transporter activity
GO:0030150 2.15% protein import into mitochondrial matrix
GO:0006090 2.15% pyruvate metabolic process
GO:0009566 2.15% fertilization
GO:0046390 2.15% ribose phosphate biosynthetic process
GO:0009967 2.15% positive regulation of signal transduction
GO:0009451 2.15% RNA modification
GO:0007017 2.15% microtubule-based process
GO:0042445 2.14% hormone metabolic process
GO:0006260 2.14% DNA replication
GO:0034655 2.14% nucleobase-containing compound catabolic process
GO:1903998 2.14% regulation of eating behavior
GO:0010243 2.14% response to organonitrogen compound
GO:0010043 2.13% response to zinc ion
GO:0048284 2.13% organelle fusion
GO:0008037 2.13% cell recognition
GO:0032269 2.13% negative regulation of cellular protein metabolic process
GO:0051051 2.12% negative regulation of transport
GO:0006995 2.12% cellular response to nitrogen starvation
GO:0051156 2.12% glucose 6-phosphate metabolic process
GO:0033617 2.12% mitochondrial respiratory chain complex IV assembly
GO:0006740 2.11% NADPH regeneration
GO:0006813 2.11% potassium ion transport
GO:0071852 2.11% fungal-type cell wall organization or biogenesis
GO:0050830 2.11% defense response to Gram-positive bacterium
GO:0010605 2.11% negative regulation of macromolecule metabolic process
GO:1905897 2.10% regulation of response to endoplasmic reticulum stress
GO:0031505 2.10% fungal-type cell wall organization
GO:0006888 2.10% endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0022618 2.10% ribonucleoprotein complex assembly
GO:0006721 2.09% terpenoid metabolic process
GO:0009755 2.09% hormone-mediated signaling pathway
GO:0010648 2.09% negative regulation of cell communication
GO:0009071 2.09% serine family amino acid catabolic process
GO:0050795 2.09% regulation of behavior
GO:0097035 2.08% regulation of membrane lipid distribution
GO:0008033 2.08% tRNA processing
GO:0042026 2.08% protein refolding
GO:0006953 2.07% acute-phase response
GO:0099402 2.07% plant organ development
GO:0031399 2.07% regulation of protein modification process
GO:0050890 2.06% cognition
GO:1901605 2.06% alpha-amino acid metabolic process
GO:0009410 2.06% response to xenobiotic stimulus
GO:0051054 2.06% positive regulation of DNA metabolic process
GO:0035821 2.05% modification of morphology or physiology of other organism
GO:0045472 2.05% response to ether
GO:0030162 2.05% regulation of proteolysis
GO:0046686 2.05% response to cadmium ion
GO:1903047 2.04% mitotic cell cycle process
GO:0010155 2.04% regulation of proton transport
GO:0007035 2.04% vacuolar acidification
GO:0030029 2.04% actin filament-based process
GO:0009734 2.04% auxin-activated signaling pathway
GO:0032880 2.04% regulation of protein localization
GO:0048193 2.04% Golgi vesicle transport
GO:1902533 2.04% positive regulation of intracellular signal transduction
GO:0008637 2.04% apoptotic mitochondrial changes
GO:0009262 2.03% deoxyribonucleotide metabolic process
GO:0050807 2.03% regulation of synapse organization
GO:0023057 2.03% negative regulation of signaling
GO:0055093 2.03% response to hyperoxia
GO:0007568 2.03% aging
GO:0051452 2.03% intracellular pH reduction
GO:0007601 2.03% visual perception
GO:0003012 2.03% muscle system process
GO:0048580 2.02% regulation of post-embryonic development
GO:0097588 2.02% archaeal or bacterial-type flagellum-dependent cell motility
GO:0006323 2.01% DNA packaging
GO:1903008 2.01% organelle disassembly
GO:0042330 2.01% taxis
GO:0048511 2.01% rhythmic process
GO:0050953 2.00% sensory perception of light stimulus
GO:0006120 2.00% mitochondrial electron transport, NADH to ubiquinone
GO:0006885 2.00% regulation of pH
GO:2000026 2.00% regulation of multicellular organismal development
GO:0008535 2.00% respiratory chain complex IV assembly
GO:2000241 2.00% regulation of reproductive process
GO:1905039 2.00% carboxylic acid transmembrane transport
GO:0009112 1.99% nucleobase metabolic process
GO:0071826 1.99% ribonucleoprotein complex subunit organization
GO:1900180 1.99% regulation of protein localization to nucleus
GO:0023061 1.99% signal release
GO:1903509 1.99% liposaccharide metabolic process
GO:1905954 1.98% positive regulation of lipid localization
GO:0006400 1.98% tRNA modification
GO:0043648 1.98% dicarboxylic acid metabolic process
GO:0051172 1.98% negative regulation of nitrogen compound metabolic process
GO:0010286 1.97% heat acclimation
GO:0045833 1.97% negative regulation of lipid metabolic process
GO:0045851 1.96% pH reduction
GO:0051129 1.96% negative regulation of cellular component organization
GO:0051173 1.96% positive regulation of nitrogen compound metabolic process
GO:0015893 1.96% drug transport
GO:0006936 1.96% muscle contraction
GO:0051248 1.96% negative regulation of protein metabolic process
GO:0007034 1.96% vacuolar transport
GO:0051289 1.96% protein homotetramerization
GO:0009081 1.96% branched-chain amino acid metabolic process
GO:0010212 1.95% response to ionizing radiation
GO:0051453 1.95% regulation of intracellular pH
GO:0030641 1.95% regulation of cellular pH
GO:0002831 1.95% regulation of response to biotic stimulus
GO:0046822 1.94% regulation of nucleocytoplasmic transport
GO:0098609 1.94% cell-cell adhesion
GO:0032989 1.94% cellular component morphogenesis
GO:0006935 1.94% chemotaxis
GO:0016241 1.93% regulation of macroautophagy
GO:0034660 1.93% ncRNA metabolic process
GO:0009790 1.93% embryo development
GO:1900182 1.93% positive regulation of protein localization to nucleus
GO:0044283 1.93% small molecule biosynthetic process
GO:0006325 1.93% chromatin organization
GO:0071805 1.93% potassium ion transmembrane transport
GO:0006470 1.92% protein dephosphorylation
GO:0034219 1.92% carbohydrate transmembrane transport
GO:0015986 1.92% ATP synthesis coupled proton transport
GO:0032535 1.91% regulation of cellular component size
GO:0055088 1.91% lipid homeostasis
GO:0015985 1.91% energy coupled proton transport, down electrochemical gradient
GO:0009791 1.91% post-embryonic development
GO:0072521 1.91% purine-containing compound metabolic process
GO:0043248 1.91% proteasome assembly
GO:0006413 1.91% translational initiation
GO:1903046 1.90% meiotic cell cycle process
GO:0051591 1.90% response to cAMP
GO:0033013 1.90% tetrapyrrole metabolic process
GO:0051560 1.90% mitochondrial calcium ion homeostasis
GO:0032006 1.90% regulation of TOR signaling
GO:0006518 1.90% peptide metabolic process
GO:0044703 1.89% multi-organism reproductive process
GO:0034767 1.89% positive regulation of ion transmembrane transport
GO:0090066 1.89% regulation of anatomical structure size
GO:0045834 1.89% positive regulation of lipid metabolic process
GO:0046148 1.89% pigment biosynthetic process
GO:0071554 1.89% cell wall organization or biogenesis
GO:0009743 1.89% response to carbohydrate
GO:0042180 1.89% cellular ketone metabolic process
GO:0030099 1.89% myeloid cell differentiation
GO:0099177 1.89% regulation of trans-synaptic signaling
GO:0044257 1.88% cellular protein catabolic process
GO:0014074 1.88% response to purine-containing compound
GO:1904064 1.88% positive regulation of cation transmembrane transport
GO:0008654 1.88% phospholipid biosynthetic process
GO:1905952 1.88% regulation of lipid localization
GO:0019748 1.88% secondary metabolic process
GO:0010675 1.88% regulation of cellular carbohydrate metabolic process
GO:0055067 1.88% monovalent inorganic cation homeostasis
GO:0006544 1.88% glycine metabolic process
GO:1905477 1.88% positive regulation of protein localization to membrane
GO:0044057 1.87% regulation of system process
GO:0010029 1.87% regulation of seed germination
GO:0031333 1.87% negative regulation of protein complex assembly
GO:0071555 1.87% cell wall organization
GO:0007584 1.87% response to nutrient
GO:0051241 1.86% negative regulation of multicellular organismal process
GO:0010639 1.86% negative regulation of organelle organization
GO:1901699 1.86% cellular response to nitrogen compound
GO:0046320 1.86% regulation of fatty acid oxidation
GO:1904589 1.86% regulation of protein import
GO:0008203 1.86% cholesterol metabolic process
GO:0009968 1.86% negative regulation of signal transduction
GO:0009263 1.85% deoxyribonucleotide biosynthetic process
GO:0046486 1.85% glycerolipid metabolic process
GO:0072527 1.85% pyrimidine-containing compound metabolic process
GO:0015749 1.85% monosaccharide transmembrane transport
GO:0006937 1.85% regulation of muscle contraction
GO:0019915 1.85% lipid storage
GO:0047484 1.85% regulation of response to osmotic stress
GO:0040007 1.85% growth
GO:1905475 1.85% regulation of protein localization to membrane
GO:0051130 1.85% positive regulation of cellular component organization
GO:0009914 1.85% hormone transport
GO:0043604 1.84% amide biosynthetic process
GO:0007059 1.84% chromosome segregation
GO:1900101 1.84% regulation of endoplasmic reticulum unfolded protein response
GO:0050804 1.84% modulation of chemical synaptic transmission
GO:0009890 1.84% negative regulation of biosynthetic process
GO:0007612 1.83% learning
GO:0090087 1.83% regulation of peptide transport
GO:0051603 1.83% proteolysis involved in cellular protein catabolic process
GO:0001731 1.83% formation of translation preinitiation complex
GO:0006644 1.83% phospholipid metabolic process
GO:0007589 1.83% body fluid secretion
GO:0016071 1.83% mRNA metabolic process
GO:0009629 1.82% response to gravity
GO:0030534 1.82% adult behavior
GO:0043062 1.82% extracellular structure organization
GO:0050954 1.82% sensory perception of mechanical stimulus
GO:0051726 1.82% regulation of cell cycle
GO:0006914 1.82% autophagy
GO:0000281 1.82% mitotic cytokinesis
GO:0051240 1.82% positive regulation of multicellular organismal process
GO:0043200 1.82% response to amino acid
GO:0042761 1.81% very long-chain fatty acid biosynthetic process
GO:0034764 1.81% positive regulation of transmembrane transport
GO:0009626 1.81% plant-type hypersensitive response
GO:0090257 1.81% regulation of muscle system process
GO:0007006 1.81% mitochondrial membrane organization
GO:0043902 1.80% positive regulation of multi-organism process
GO:0002097 1.80% tRNA wobble base modification
GO:0033674 1.80% positive regulation of kinase activity
GO:0022603 1.80% regulation of anatomical structure morphogenesis
GO:0007507 1.80% heart development
GO:0006778 1.80% porphyrin-containing compound metabolic process
GO:0010563 1.80% negative regulation of phosphorus metabolic process
GO:1903825 1.79% organic acid transmembrane transport
GO:0018193 1.79% peptidyl-amino acid modification
GO:0045017 1.79% glycerolipid biosynthetic process
GO:0061919 1.79% process utilizing autophagic mechanism
GO:0006412 1.79% translation
GO:0019693 1.79% ribose phosphate metabolic process
GO:0010042 1.79% response to manganese ion
GO:0006144 1.79% purine nucleobase metabolic process
GO:0018065 1.78% protein-cofactor linkage
GO:0051339 1.78% regulation of lyase activity
GO:0045185 1.78% maintenance of protein location
GO:0045912 1.78% negative regulation of carbohydrate metabolic process
GO:0009152 1.78% purine ribonucleotide biosynthetic process
GO:0043901 1.78% negative regulation of multi-organism process
GO:0048589 1.78% developmental growth
GO:0030198 1.78% extracellular matrix organization
GO:0042306 1.77% regulation of protein import into nucleus
GO:0045936 1.77% negative regulation of phosphate metabolic process
GO:0046999 1.77% regulation of conjugation
GO:0060627 1.77% regulation of vesicle-mediated transport
GO:0008380 1.76% RNA splicing
GO:0061448 1.76% connective tissue development
GO:0055074 1.76% calcium ion homeostasis
GO:1904062 1.76% regulation of cation transmembrane transport
GO:0009723 1.76% response to ethylene
GO:0006777 1.76% Mo-molybdopterin cofactor biosynthetic process
GO:0051205 1.75% protein insertion into membrane
GO:0007585 1.75% respiratory gaseous exchange by respiratory system
GO:0048468 1.75% cell development
GO:1902074 1.75% response to salt
GO:0006650 1.75% glycerophospholipid metabolic process
GO:0055081 1.75% anion homeostasis
GO:0002098 1.75% tRNA wobble uridine modification
GO:0045229 1.75% external encapsulating structure organization
GO:0009259 1.75% ribonucleotide metabolic process
GO:1900140 1.75% regulation of seedling development
GO:0031327 1.75% negative regulation of cellular biosynthetic process
GO:0051302 1.75% regulation of cell division
GO:0018958 1.75% phenol-containing compound metabolic process
GO:0043043 1.75% peptide biosynthetic process
GO:0061640 1.74% cytoskeleton-dependent cytokinesis
GO:0002164 1.74% larval development
GO:0016125 1.74% sterol metabolic process
GO:0060537 1.74% muscle tissue development
GO:0006720 1.74% isoprenoid metabolic process
GO:0051181 1.73% cofactor transport
GO:0002183 1.73% cytoplasmic translational initiation
GO:0051301 1.72% cell division
GO:0050776 1.72% regulation of immune response
GO:0007204 1.72% positive regulation of cytosolic calcium ion concentration
GO:0006643 1.72% membrane lipid metabolic process
GO:0002526 1.71% acute inflammatory response
GO:0040008 1.71% regulation of growth
GO:0009733 1.71% response to auxin
GO:0072655 1.71% establishment of protein localization to mitochondrion
GO:0043549 1.71% regulation of kinase activity
GO:0002252 1.71% immune effector process
GO:0042327 1.71% positive regulation of phosphorylation
GO:0031347 1.70% regulation of defense response
GO:0007605 1.70% sensory perception of sound
GO:0006874 1.70% cellular calcium ion homeostasis
GO:0072350 1.70% tricarboxylic acid metabolic process
GO:0046683 1.70% response to organophosphorus
GO:0097306 1.70% cellular response to alcohol
GO:0019953 1.70% sexual reproduction
GO:0007167 1.70% enzyme linked receptor protein signaling pathway
GO:0010942 1.70% positive regulation of cell death
GO:0051607 1.69% defense response to virus
GO:0010906 1.69% regulation of glucose metabolic process
GO:0008217 1.69% regulation of blood pressure
GO:0090316 1.69% positive regulation of intracellular protein transport
GO:0042304 1.69% regulation of fatty acid biosynthetic process
GO:0051348 1.69% negative regulation of transferase activity
GO:0034470 1.69% ncRNA processing
GO:0061912 1.68% selective autophagy
GO:0051052 1.68% regulation of DNA metabolic process
GO:0006865 1.68% amino acid transport
GO:0006081 1.68% cellular aldehyde metabolic process
GO:0001932 1.68% regulation of protein phosphorylation
GO:0072666 1.67% establishment of protein localization to vacuole
GO:0030218 1.67% erythrocyte differentiation
GO:0010562 1.67% positive regulation of phosphorus metabolic process
GO:0048232 1.67% male gamete generation
GO:0018298 1.67% protein-chromophore linkage
GO:0007283 1.67% spermatogenesis
GO:1901136 1.67% carbohydrate derivative catabolic process
GO:0051924 1.67% regulation of calcium ion transport
GO:0007276 1.67% gamete generation
GO:0051223 1.67% regulation of protein transport
GO:0044275 1.67% cellular carbohydrate catabolic process
GO:2000024 1.67% regulation of leaf development
GO:0042771 1.67% intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042446 1.66% hormone biosynthetic process
GO:2001057 1.66% reactive nitrogen species metabolic process
GO:0007399 1.66% nervous system development
GO:0071417 1.66% cellular response to organonitrogen compound
GO:0043327 1.66% chemotaxis to cAMP
GO:0061687 1.65% detoxification of inorganic compound
GO:0051055 1.65% negative regulation of lipid biosynthetic process
GO:0030004 1.65% cellular monovalent inorganic cation homeostasis
GO:0009069 1.65% serine family amino acid metabolic process
GO:0001817 1.65% regulation of cytokine production
GO:0043545 1.65% molybdopterin cofactor metabolic process
GO:0006265 1.65% DNA topological change
GO:0010629 1.65% negative regulation of gene expression
GO:0006397 1.65% mRNA processing
GO:0010608 1.65% posttranscriptional regulation of gene expression
GO:0045937 1.65% positive regulation of phosphate metabolic process
GO:0097327 1.65% response to antineoplastic agent
GO:0062013 1.65% positive regulation of small molecule metabolic process
GO:0032507 1.64% maintenance of protein location in cell
GO:0030261 1.64% chromosome condensation
GO:0050808 1.64% synapse organization
GO:0006661 1.64% phosphatidylinositol biosynthetic process
GO:0001503 1.64% ossification
GO:0044089 1.64% positive regulation of cellular component biogenesis
GO:0022613 1.64% ribonucleoprotein complex biogenesis
GO:0043068 1.64% positive regulation of programmed cell death
GO:0007623 1.63% circadian rhythm
GO:0016051 1.63% carbohydrate biosynthetic process
GO:0007626 1.63% locomotory behavior
GO:0001906 1.63% cell killing
GO:0007611 1.63% learning or memory
GO:0031331 1.63% positive regulation of cellular catabolic process
GO:0009185 1.63% ribonucleoside diphosphate metabolic process
GO:0051321 1.62% meiotic cell cycle
GO:0006163 1.62% purine nucleotide metabolic process
GO:0051705 1.62% multi-organism behavior
GO:0009896 1.62% positive regulation of catabolic process
GO:0043112 1.61% receptor metabolic process
GO:0070585 1.61% protein localization to mitochondrion
GO:0009887 1.61% animal organ morphogenesis
GO:0071495 1.61% cellular response to endogenous stimulus
GO:0051480 1.61% regulation of cytosolic calcium ion concentration
GO:0006664 1.61% glycolipid metabolic process
GO:0051881 1.61% regulation of mitochondrial membrane potential
GO:0052547 1.61% regulation of peptidase activity
GO:0002682 1.60% regulation of immune system process
GO:0001523 1.60% retinoid metabolic process
GO:0043122 1.60% regulation of I-kappaB kinase/NF-kappaB signaling
GO:0072503 1.60% cellular divalent inorganic cation homeostasis
GO:0006414 1.60% translational elongation
GO:0019221 1.60% cytokine-mediated signaling pathway
GO:0045494 1.60% photoreceptor cell maintenance
GO:0006887 1.60% exocytosis
GO:0043624 1.60% cellular protein complex disassembly
GO:2000377 1.60% regulation of reactive oxygen species metabolic process
GO:0046474 1.60% glycerophospholipid biosynthetic process
GO:0140253 1.59% cell-cell fusion
GO:0007586 1.59% digestion
GO:0033673 1.59% negative regulation of kinase activity
GO:0070201 1.59% regulation of establishment of protein localization
GO:0044364 1.59% disruption of cells of other organism
GO:0032387 1.59% negative regulation of intracellular transport
GO:0046365 1.59% monosaccharide catabolic process
GO:1901031 1.59% regulation of response to reactive oxygen species
GO:0070071 1.59% proton-transporting two-sector ATPase complex assembly
GO:0007417 1.59% central nervous system development
GO:0031640 1.59% killing of cells of other organism
GO:0015721 1.58% bile acid and bile salt transport
GO:0001708 1.58% cell fate specification
GO:0006275 1.58% regulation of DNA replication
GO:0035194 1.58% posttranscriptional gene silencing by RNA
GO:0030163 1.58% protein catabolic process
GO:0006089 1.58% lactate metabolic process
GO:0090596 1.57% sensory organ morphogenesis
GO:0032101 1.57% regulation of response to external stimulus
GO:0048608 1.57% reproductive structure development
GO:0043065 1.57% positive regulation of apoptotic process
GO:0072332 1.57% intrinsic apoptotic signaling pathway by p53 class mediator
GO:0030317 1.56% flagellated sperm motility
GO:0051017 1.56% actin filament bundle assembly
GO:0051189 1.56% prosthetic group metabolic process
GO:0044085 1.56% cellular component biogenesis
GO:0019720 1.56% Mo-molybdopterin cofactor metabolic process
GO:0043255 1.56% regulation of carbohydrate biosynthetic process
GO:0060259 1.56% regulation of feeding behavior
GO:0072331 1.56% signal transduction by p53 class mediator
GO:0008652 1.55% cellular amino acid biosynthetic process
GO:0009073 1.55% aromatic amino acid family biosynthetic process
GO:0090693 1.55% plant organ senescence
GO:0072507 1.55% divalent inorganic cation homeostasis
GO:0048145 1.55% regulation of fibroblast proliferation
GO:0051193 1.55% regulation of cofactor metabolic process
GO:0044262 1.55% cellular carbohydrate metabolic process
GO:0032392 1.55% DNA geometric change
GO:0006766 1.54% vitamin metabolic process
GO:0051701 1.54% interaction with host
GO:0051270 1.54% regulation of cellular component movement
GO:0007007 1.54% inner mitochondrial membrane organization
GO:0006164 1.54% purine nucleotide biosynthetic process
GO:0031334 1.54% positive regulation of protein complex assembly
GO:1903426 1.54% regulation of reactive oxygen species biosynthetic process
GO:0009751 1.54% response to salicylic acid
GO:0019236 1.53% response to pheromone
GO:0048729 1.53% tissue morphogenesis
GO:0072595 1.53% maintenance of protein localization in organelle
GO:0032414 1.53% positive regulation of ion transmembrane transporter activity
GO:0007031 1.52% peroxisome organization
GO:0007338 1.52% single fertilization
GO:0035176 1.52% social behavior
GO:0032508 1.52% DNA duplex unwinding
GO:0009142 1.52% nucleoside triphosphate biosynthetic process
GO:0031023 1.52% microtubule organizing center organization
GO:0044550 1.52% secondary metabolite biosynthetic process
GO:0046488 1.52% phosphatidylinositol metabolic process
GO:0009792 1.52% embryo development ending in birth or egg hatching
GO:0009150 1.52% purine ribonucleotide metabolic process
GO:0051094 1.52% positive regulation of developmental process
GO:0016441 1.51% posttranscriptional gene silencing
GO:0009141 1.51% nucleoside triphosphate metabolic process
GO:1902882 1.51% regulation of response to oxidative stress
GO:0010150 1.51% leaf senescence
GO:0043094 1.51% cellular metabolic compound salvage
GO:0032388 1.51% positive regulation of intracellular transport
GO:0009108 1.51% coenzyme biosynthetic process
GO:0048167 1.51% regulation of synaptic plasticity
GO:0045860 1.51% positive regulation of protein kinase activity
GO:0048592 1.51% eye morphogenesis
GO:1904377 1.50% positive regulation of protein localization to cell periphery
GO:2001020 1.50% regulation of response to DNA damage stimulus
GO:0019320 1.50% hexose catabolic process
GO:1900407 1.50% regulation of cellular response to oxidative stress
GO:0071941 1.50% nitrogen cycle metabolic process
GO:0021700 1.50% developmental maturation
GO:0042776 1.50% mitochondrial ATP synthesis coupled proton transport
GO:0031401 1.50% positive regulation of protein modification process
GO:0005976 1.49% polysaccharide metabolic process
GO:0009251 1.49% glucan catabolic process
GO:0009201 1.49% ribonucleoside triphosphate biosynthetic process
GO:0051101 1.49% regulation of DNA binding
GO:0071276 1.49% cellular response to cadmium ion
GO:0010466 1.49% negative regulation of peptidase activity
GO:0007617 1.49% mating behavior
GO:0000377 1.49% RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0008285 1.48% negative regulation of cell population proliferation
GO:0033014 1.48% tetrapyrrole biosynthetic process
GO:0045934 1.48% negative regulation of nucleobase-containing compound metabolic process
GO:0016042 1.48% lipid catabolic process
GO:0044070 1.48% regulation of anion transport
GO:0006732 1.48% coenzyme metabolic process
GO:0006357 1.48% regulation of transcription by RNA polymerase II
GO:0034620 1.48% cellular response to unfolded protein
GO:0008344 1.48% adult locomotory behavior
GO:0051093 1.48% negative regulation of developmental process
GO:0033146 1.48% regulation of intracellular estrogen receptor signaling pathway
GO:1903078 1.47% positive regulation of protein localization to plasma membrane
GO:0042168 1.47% heme metabolic process
GO:0001934 1.47% positive regulation of protein phosphorylation
GO:0022413 1.47% reproductive process in single-celled organism
GO:0009753 1.47% response to jasmonic acid
GO:0051247 1.47% positive regulation of protein metabolic process
GO:0006817 1.47% phosphate ion transport
GO:1903432 1.47% regulation of TORC1 signaling
GO:0009583 1.47% detection of light stimulus
GO:0009793 1.47% embryo development ending in seed dormancy
GO:0006821 1.46% chloride transport
GO:0070527 1.46% platelet aggregation
GO:0051170 1.46% import into nucleus
GO:0032411 1.46% positive regulation of transporter activity
GO:0090317 1.46% negative regulation of intracellular protein transport
GO:0042572 1.46% retinol metabolic process
GO:0032368 1.46% regulation of lipid transport
GO:0000272 1.45% polysaccharide catabolic process
GO:0051261 1.45% protein depolymerization
GO:0032270 1.45% positive regulation of cellular protein metabolic process
GO:0006310 1.45% DNA recombination
GO:0097722 1.45% sperm motility
GO:0045777 1.45% positive regulation of blood pressure
GO:2000116 1.45% regulation of cysteine-type endopeptidase activity
GO:0031122 1.44% cytoplasmic microtubule organization
GO:0051090 1.44% regulation of DNA-binding transcription factor activity
GO:0000226 1.44% microtubule cytoskeleton organization
GO:0051222 1.44% positive regulation of protein transport
GO:0042326 1.44% negative regulation of phosphorylation
GO:0072347 1.44% response to anesthetic
GO:0032370 1.43% positive regulation of lipid transport
GO:0048678 1.43% response to axon injury
GO:0140115 1.43% export across plasma membrane
GO:0071897 1.43% DNA biosynthetic process
GO:0031047 1.43% gene silencing by RNA
GO:0009891 1.43% positive regulation of biosynthetic process
GO:0006805 1.43% xenobiotic metabolic process
GO:0007168 1.43% receptor guanylyl cyclase signaling pathway
GO:0033209 1.42% tumor necrosis factor-mediated signaling pathway
GO:0009312 1.42% oligosaccharide biosynthetic process
GO:0002119 1.42% nematode larval development
GO:0009145 1.42% purine nucleoside triphosphate biosynthetic process
GO:0032526 1.42% response to retinoic acid
GO:0009206 1.42% purine ribonucleoside triphosphate biosynthetic process
GO:0006549 1.42% isoleucine metabolic process
GO:0009712 1.42% catechol-containing compound metabolic process
GO:0071407 1.41% cellular response to organic cyclic compound
GO:0009311 1.41% oligosaccharide metabolic process
GO:0040012 1.41% regulation of locomotion
GO:0009082 1.41% branched-chain amino acid biosynthetic process
GO:0000375 1.41% RNA splicing, via transesterification reactions
GO:0046470 1.41% phosphatidylcholine metabolic process
GO:0009886 1.41% post-embryonic animal morphogenesis
GO:0016050 1.41% vesicle organization
GO:0046889 1.41% positive regulation of lipid biosynthetic process
GO:0040017 1.41% positive regulation of locomotion
GO:0048545 1.41% response to steroid hormone
GO:0010638 1.41% positive regulation of organelle organization
GO:0000917 1.41% division septum assembly
GO:1901607 1.41% alpha-amino acid biosynthetic process
GO:0045444 1.41% fat cell differentiation
GO:0050994 1.40% regulation of lipid catabolic process
GO:0015931 1.40% nucleobase-containing compound transport
GO:1904951 1.40% positive regulation of establishment of protein localization
GO:0034504 1.40% protein localization to nucleus
GO:0034754 1.40% cellular hormone metabolic process
GO:0006941 1.40% striated muscle contraction
GO:0032506 1.40% cytokinetic process
GO:0007602 1.40% phototransduction
GO:0030968 1.40% endoplasmic reticulum unfolded protein response
GO:0006111 1.40% regulation of gluconeogenesis
GO:0006641 1.40% triglyceride metabolic process
GO:0007349 1.40% cellularization
GO:0000902 1.40% cell morphogenesis
GO:0120163 1.39% negative regulation of cold-induced thermogenesis
GO:0016101 1.39% diterpenoid metabolic process
GO:0006779 1.39% porphyrin-containing compound biosynthetic process
GO:0061572 1.39% actin filament bundle organization
GO:0052548 1.39% regulation of endopeptidase activity
GO:0048544 1.39% recognition of pollen
GO:2000677 1.39% regulation of transcription regulatory region DNA binding
GO:0006623 1.39% protein targeting to vacuole
GO:0032774 1.39% RNA biosynthetic process
GO:0060285 1.39% cilium-dependent cell motility
GO:0034109 1.38% homotypic cell-cell adhesion
GO:0002437 1.38% inflammatory response to antigenic stimulus
GO:0043123 1.38% positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045861 1.38% negative regulation of proteolysis
GO:0098586 1.38% cellular response to virus
GO:0008645 1.38% hexose transmembrane transport
GO:0019400 1.38% alditol metabolic process
GO:0030030 1.38% cell projection organization
GO:0006573 1.37% valine metabolic process
GO:0071345 1.37% cellular response to cytokine stimulus
GO:1903205 1.37% regulation of hydrogen peroxide-induced cell death
GO:0072528 1.37% pyrimidine-containing compound biosynthetic process
GO:0031137 1.37% regulation of conjugation with cellular fusion
GO:0048831 1.37% regulation of shoot system development
GO:0034763 1.37% negative regulation of transmembrane transport
GO:0030036 1.36% actin cytoskeleton organization
GO:0006221 1.36% pyrimidine nucleotide biosynthetic process
GO:0071277 1.36% cellular response to calcium ion
GO:0008306 1.36% associative learning
GO:0000278 1.36% mitotic cell cycle
GO:0034248 1.36% regulation of cellular amide metabolic process
GO:1900408 1.36% negative regulation of cellular response to oxidative stress
GO:0014706 1.36% striated muscle tissue development
GO:0044264 1.36% cellular polysaccharide metabolic process
GO:1901658 1.36% glycosyl compound catabolic process
GO:0050810 1.36% regulation of steroid biosynthetic process
GO:0046777 1.35% protein autophosphorylation
GO:0001819 1.35% positive regulation of cytokine production
GO:0000160 1.35% phosphorelay signal transduction system
GO:0002832 1.35% negative regulation of response to biotic stimulus
GO:1903317 1.35% regulation of protein maturation
GO:0042178 1.35% xenobiotic catabolic process
GO:0031136 1.35% positive regulation of conjugation
GO:0048146 1.35% positive regulation of fibroblast proliferation
GO:0034097 1.35% response to cytokine
GO:0043388 1.35% positive regulation of DNA binding
GO:0006606 1.35% protein import into nucleus
GO:1903202 1.35% negative regulation of oxidative stress-induced cell death
GO:0072522 1.35% purine-containing compound biosynthetic process
GO:0098926 1.34% postsynaptic signal transduction
GO:0006401 1.34% RNA catabolic process
GO:0060612 1.34% adipose tissue development
GO:0046879 1.34% hormone secretion
GO:0070925 1.34% organelle assembly
GO:0071479 1.34% cellular response to ionizing radiation
GO:0031139 1.34% positive regulation of conjugation with cellular fusion
GO:2000113 1.34% negative regulation of cellular macromolecule biosynthetic process
GO:2000145 1.34% regulation of cell motility
GO:0051817 1.34% modification of morphology or physiology of other organism involved in symbiotic interaction
GO:0006376 1.33% mRNA splice site selection
GO:0033500 1.33% carbohydrate homeostasis
GO:0033143 1.33% regulation of intracellular steroid hormone receptor signaling pathway
GO:0009144 1.33% purine nucleoside triphosphate metabolic process
GO:0000398 1.33% mRNA splicing, via spliceosome
GO:0040029 1.33% regulation of gene expression, epigenetic
GO:0007423 1.33% sensory organ development
GO:0031670 1.33% cellular response to nutrient
GO:2000649 1.33% regulation of sodium ion transmembrane transporter activity
GO:0046185 1.33% aldehyde catabolic process
GO:2000243 1.32% positive regulation of reproductive process
GO:0007099 1.32% centriole replication
GO:0000002 1.32% mitochondrial genome maintenance
GO:0042593 1.32% glucose homeostasis
GO:0050764 1.32% regulation of phagocytosis
GO:0010558 1.32% negative regulation of macromolecule biosynthetic process
GO:1902532 1.32% negative regulation of intracellular signal transduction
GO:0045595 1.32% regulation of cell differentiation
GO:0034310 1.32% primary alcohol catabolic process
GO:1990928 1.32% response to amino acid starvation
GO:0019395 1.31% fatty acid oxidation
GO:0032465 1.31% regulation of cytokinesis
GO:0046825 1.31% regulation of protein export from nucleus
GO:0010119 1.31% regulation of stomatal movement
GO:0032271 1.31% regulation of protein polymerization
GO:0051272 1.31% positive regulation of cellular component movement
GO:0009062 1.31% fatty acid catabolic process
GO:0009860 1.31% pollen tube growth
GO:0007389 1.31% pattern specification process
GO:0009746 1.31% response to hexose
GO:1903727 1.31% positive regulation of phospholipid metabolic process
GO:0045922 1.31% negative regulation of fatty acid metabolic process
GO:0051098 1.30% regulation of binding
GO:0000724 1.30% double-strand break repair via homologous recombination
GO:0098661 1.30% inorganic anion transmembrane transport
GO:0005984 1.30% disaccharide metabolic process
GO:0072698 1.30% protein localization to microtubule cytoskeleton
GO:0008544 1.30% epidermis development
GO:0045786 1.30% negative regulation of cell cycle
GO:0006302 1.30% double-strand break repair
GO:0045859 1.30% regulation of protein kinase activity
GO:0016239 1.30% positive regulation of macroautophagy
GO:0007281 1.30% germ cell development
GO:0045598 1.29% regulation of fat cell differentiation
GO:0045923 1.29% positive regulation of fatty acid metabolic process
GO:0043627 1.29% response to estrogen
GO:0006613 1.29% cotranslational protein targeting to membrane
GO:1900076 1.29% regulation of cellular response to insulin stimulus
GO:0044247 1.29% cellular polysaccharide catabolic process
GO:0048588 1.29% developmental cell growth
GO:0016567 1.29% protein ubiquitination
GO:0022404 1.29% molting cycle process
GO:2000378 1.29% negative regulation of reactive oxygen species metabolic process
GO:1905710 1.29% positive regulation of membrane permeability
GO:0050909 1.29% sensory perception of taste
GO:0051668 1.28% localization within membrane
GO:2000242 1.28% negative regulation of reproductive process
GO:0099643 1.28% signal release from synapse
GO:0009308 1.28% amine metabolic process
GO:0007160 1.28% cell-matrix adhesion
GO:0009699 1.28% phenylpropanoid biosynthetic process
GO:0019941 1.28% modification-dependent protein catabolic process
GO:0001818 1.28% negative regulation of cytokine production
GO:0006639 1.27% acylglycerol metabolic process
GO:0031929 1.27% TOR signaling
GO:0010564 1.27% regulation of cell cycle process
GO:0006220 1.27% pyrimidine nucleotide metabolic process
GO:0006816 1.27% calcium ion transport
GO:0014823 1.27% response to activity
GO:0090529 1.27% cell septum assembly
GO:0001775 1.27% cell activation
GO:0000725 1.27% recombinational repair
GO:0034284 1.27% response to monosaccharide
GO:0009606 1.27% tropism
GO:0010811 1.27% positive regulation of cell-substrate adhesion
GO:0031330 1.27% negative regulation of cellular catabolic process
GO:0051818 1.27% disruption of cells of other organism involved in symbiotic interaction
GO:0046467 1.26% membrane lipid biosynthetic process
GO:0048871 1.26% multicellular organismal homeostasis
GO:0006338 1.26% chromatin remodeling
GO:1903522 1.26% regulation of blood circulation
GO:0048582 1.26% positive regulation of post-embryonic development
GO:0032272 1.26% negative regulation of protein polymerization
GO:1903320 1.26% regulation of protein modification by small protein conjugation or removal
GO:2001233 1.26% regulation of apoptotic signaling pathway
GO:0006206 1.26% pyrimidine nucleobase metabolic process
GO:0019098 1.25% reproductive behavior
GO:0000038 1.25% very long-chain fatty acid metabolic process
GO:0045892 1.25% negative regulation of transcription, DNA-templated
GO:0090559 1.25% regulation of membrane permeability
GO:0003009 1.25% skeletal muscle contraction
GO:1903201 1.25% regulation of oxidative stress-induced cell death
GO:0051457 1.25% maintenance of protein location in nucleus
GO:0019218 1.25% regulation of steroid metabolic process
GO:1904375 1.25% regulation of protein localization to cell periphery
GO:0046902 1.25% regulation of mitochondrial membrane permeability
GO:0051253 1.25% negative regulation of RNA metabolic process
GO:0019835 1.25% cytolysis
GO:0009749 1.25% response to glucose
GO:2000280 1.25% regulation of root development
GO:0043935 1.25% sexual sporulation resulting in formation of a cellular spore
GO:0006635 1.25% fatty acid beta-oxidation
GO:0010524 1.24% positive regulation of calcium ion transport into cytosol
GO:0060560 1.24% developmental growth involved in morphogenesis
GO:0046386 1.24% deoxyribose phosphate catabolic process
GO:0098534 1.24% centriole assembly
GO:0031400 1.24% negative regulation of protein modification process
GO:0045721 1.24% negative regulation of gluconeogenesis
GO:0072529 1.24% pyrimidine-containing compound catabolic process
GO:0042181 1.24% ketone biosynthetic process
GO:0009895 1.24% negative regulation of catabolic process
GO:0030182 1.24% neuron differentiation
GO:0007595 1.23% lactation
GO:0009132 1.23% nucleoside diphosphate metabolic process
GO:0007420 1.23% brain development
GO:0050766 1.23% positive regulation of phagocytosis
GO:0030437 1.23% ascospore formation
GO:0046823 1.23% negative regulation of nucleocytoplasmic transport
GO:0006754 1.23% ATP biosynthetic process
GO:0009199 1.23% ribonucleoside triphosphate metabolic process
GO:2001242 1.23% regulation of intrinsic apoptotic signaling pathway
GO:0009867 1.23% jasmonic acid mediated signaling pathway
GO:0009264 1.23% deoxyribonucleotide catabolic process
GO:2000147 1.23% positive regulation of cell motility
GO:0051606 1.23% detection of stimulus
GO:0009135 1.22% purine nucleoside diphosphate metabolic process
GO:0045088 1.22% regulation of innate immune response
GO:0051046 1.22% regulation of secretion
GO:0006448 1.22% regulation of translational elongation
GO:0006040 1.22% amino sugar metabolic process
GO:0009637 1.22% response to blue light
GO:0006892 1.22% post-Golgi vesicle-mediated transport
GO:1903959 1.22% regulation of anion transmembrane transport
GO:1901522 1.22% positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus
GO:0044242 1.22% cellular lipid catabolic process
GO:0007632 1.22% visual behavior
GO:0070613 1.22% regulation of protein processing
GO:0045935 1.22% positive regulation of nucleobase-containing compound metabolic process
GO:0031960 1.22% response to corticosteroid
GO:2001243 1.22% negative regulation of intrinsic apoptotic signaling pathway
GO:0097659 1.21% nucleic acid-templated transcription
GO:1903076 1.21% regulation of protein localization to plasma membrane
GO:0030522 1.21% intracellular receptor signaling pathway
GO:0006468 1.21% protein phosphorylation
GO:0045187 1.21% regulation of circadian sleep/wake cycle, sleep
GO:0099003 1.21% vesicle-mediated transport in synapse
GO:1903507 1.21% negative regulation of nucleic acid-templated transcription
GO:0000422 1.21% autophagy of mitochondrion
GO:1905809 1.21% negative regulation of synapse organization
GO:0009218 1.21% pyrimidine ribonucleotide metabolic process
GO:0009220 1.21% pyrimidine ribonucleotide biosynthetic process
GO:0033273 1.21% response to vitamin
GO:0030574 1.21% collagen catabolic process
GO:0034198 1.21% cellular response to amino acid starvation
GO:1902305 1.21% regulation of sodium ion transmembrane transport
GO:0034440 1.21% lipid oxidation
GO:1990778 1.21% protein localization to cell periphery
GO:0032103 1.21% positive regulation of response to external stimulus
GO:0010677 1.21% negative regulation of cellular carbohydrate metabolic process
GO:0006261 1.21% DNA-dependent DNA replication
GO:0016458 1.20% gene silencing
GO:0009084 1.20% glutamine family amino acid biosynthetic process
GO:0042303 1.20% molting cycle
GO:0040014 1.20% regulation of multicellular organism growth
GO:1903530 1.20% regulation of secretion by cell
GO:0006767 1.20% water-soluble vitamin metabolic process
GO:0007169 1.20% transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048857 1.20% neural nucleus development
GO:0000904 1.20% cell morphogenesis involved in differentiation
GO:0008016 1.20% regulation of heart contraction
GO:2001234 1.20% negative regulation of apoptotic signaling pathway
GO:0061844 1.20% antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0043281 1.20% regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0015909 1.20% long-chain fatty acid transport
GO:0010821 1.19% regulation of mitochondrion organization
GO:0016477 1.19% cell migration
GO:0051883 1.19% killing of cells in other organism involved in symbiotic interaction
GO:0032008 1.19% positive regulation of TOR signaling
GO:0009064 1.19% glutamine family amino acid metabolic process
GO:0030855 1.19% epithelial cell differentiation
GO:0061726 1.19% mitochondrion disassembly
GO:1901214 1.19% regulation of neuron death
GO:0006638 1.18% neutral lipid metabolic process
GO:0030042 1.18% actin filament depolymerization
GO:0035967 1.18% cellular response to topologically incorrect protein
GO:0048017 1.18% inositol lipid-mediated signaling
GO:0009404 1.18% toxin metabolic process
GO:0010628 1.18% positive regulation of gene expression
GO:0007249 1.18% I-kappaB kinase/NF-kappaB signaling
GO:0071824 1.18% protein-DNA complex subunit organization
GO:0010288 1.18% response to lead ion
GO:0061025 1.18% membrane fusion
GO:0009437 1.18% carnitine metabolic process
GO:1903321 1.18% negative regulation of protein modification by small protein conjugation or removal
GO:0043408 1.18% regulation of MAPK cascade
GO:0045785 1.18% positive regulation of cell adhesion
GO:0043087 1.17% regulation of GTPase activity
GO:0031328 1.17% positive regulation of cellular biosynthetic process
GO:0042182 1.17% ketone catabolic process
GO:0019692 1.17% deoxyribose phosphate metabolic process
GO:0006575 1.17% cellular modified amino acid metabolic process
GO:0006289 1.17% nucleotide-excision repair
GO:0061462 1.17% protein localization to lysosome
GO:0001895 1.17% retina homeostasis
GO:0006814 1.17% sodium ion transport
GO:0006417 1.17% regulation of translation
GO:0030335 1.17% positive regulation of cell migration
GO:0045980 1.16% negative regulation of nucleotide metabolic process
GO:0006891 1.16% intra-Golgi vesicle-mediated transport
GO:0010927 1.16% cellular component assembly involved in morphogenesis
GO:0045926 1.16% negative regulation of growth
GO:0006584 1.16% catecholamine metabolic process
GO:0050892 1.16% intestinal absorption
GO:1903831 1.16% signal transduction involved in cellular response to ammonium ion
GO:0051649 1.16% establishment of localization in cell
GO:0044106 1.16% cellular amine metabolic process
GO:0043632 1.16% modification-dependent macromolecule catabolic process
GO:0009072 1.16% aromatic amino acid family metabolic process
GO:0006694 1.16% steroid biosynthetic process
GO:0009068 1.16% aspartate family amino acid catabolic process
GO:1902679 1.16% negative regulation of RNA biosynthetic process
GO:0007569 1.15% cell aging
GO:0032410 1.15% negative regulation of transporter activity
GO:1901616 1.15% organic hydroxy compound catabolic process
GO:0031349 1.15% positive regulation of defense response
GO:0032094 1.15% response to food
GO:0001889 1.15% liver development
GO:0000271 1.15% polysaccharide biosynthetic process
GO:0009639 1.15% response to red or far red light
GO:0006775 1.15% fat-soluble vitamin metabolic process
GO:0010893 1.15% positive regulation of steroid biosynthetic process
GO:0009179 1.15% purine ribonucleoside diphosphate metabolic process
GO:0006351 1.15% transcription, DNA-templated
GO:0006836 1.15% neurotransmitter transport
GO:0090329 1.14% regulation of DNA-dependent DNA replication
GO:0042749 1.14% regulation of circadian sleep/wake cycle
GO:0048520 1.14% positive regulation of behavior
GO:0006352 1.14% DNA-templated transcription, initiation
GO:0006576 1.14% cellular biogenic amine metabolic process
GO:0090313 1.14% regulation of protein targeting to membrane
GO:0017157 1.14% regulation of exocytosis
GO:0006942 1.14% regulation of striated muscle contraction
GO:0098742 1.14% cell-cell adhesion via plasma-membrane adhesion molecules
GO:0071684 1.14% organism emergence from protective structure
GO:0046031 1.14% ADP metabolic process
GO:0030002 1.14% cellular anion homeostasis
GO:0046112 1.14% nucleobase biosynthetic process
GO:0046164 1.14% alcohol catabolic process
GO:0051384 1.14% response to glucocorticoid
GO:0071731 1.14% response to nitric oxide
GO:0042692 1.14% muscle cell differentiation
GO:0009593 1.14% detection of chemical stimulus
GO:0071902 1.13% positive regulation of protein serine/threonine kinase activity
GO:0043271 1.13% negative regulation of ion transport
GO:1904591 1.13% positive regulation of protein import
GO:0048015 1.13% phosphatidylinositol-mediated signaling
GO:0010171 1.13% body morphogenesis
GO:0070228 1.13% regulation of lymphocyte apoptotic process
GO:0048521 1.13% negative regulation of behavior
GO:0001649 1.13% osteoblast differentiation
GO:0051204 1.13% protein insertion into mitochondrial membrane
GO:0071396 1.13% cellular response to lipid
GO:0071695 1.13% anatomical structure maturation
GO:0000723 1.13% telomere maintenance
GO:0009932 1.12% cell tip growth
GO:0006511 1.12% ubiquitin-dependent protein catabolic process
GO:0050657 1.12% nucleic acid transport
GO:0002237 1.12% response to molecule of bacterial origin
GO:0030808 1.12% regulation of nucleotide biosynthetic process
GO:0043547 1.12% positive regulation of GTPase activity
GO:2000106 1.12% regulation of leukocyte apoptotic process
GO:0034227 1.12% tRNA thio-modification
GO:0032102 1.12% negative regulation of response to external stimulus
GO:0042128 1.12% nitrate assimilation
GO:0009873 1.12% ethylene-activated signaling pathway
GO:0008608 1.12% attachment of spindle microtubules to kinetochore
GO:0044042 1.12% glucan metabolic process
GO:0016049 1.12% cell growth
GO:2001038 1.12% regulation of cellular response to drug
GO:0002697 1.11% regulation of immune effector process
GO:0071480 1.11% cellular response to gamma radiation
GO:0042439 1.11% ethanolamine-containing compound metabolic process
GO:0009698 1.11% phenylpropanoid metabolic process
GO:0042752 1.11% regulation of circadian rhythm
GO:0006577 1.11% amino-acid betaine metabolic process
GO:0006566 1.11% threonine metabolic process
GO:2000117 1.11% negative regulation of cysteine-type endopeptidase activity
GO:0010948 1.11% negative regulation of cell cycle process
GO:0010467 1.11% gene expression
GO:0007264 1.11% small GTPase mediated signal transduction
GO:0010508 1.11% positive regulation of autophagy
GO:0007269 1.11% neurotransmitter secretion
GO:0019405 1.11% alditol catabolic process
GO:1901617 1.11% organic hydroxy compound biosynthetic process
GO:0009247 1.11% glycolipid biosynthetic process
GO:1903427 1.10% negative regulation of reactive oxygen species biosynthetic process
GO:1903409 1.10% reactive oxygen species biosynthetic process
GO:0006515 1.10% protein quality control for misfolded or incompletely synthesized proteins
GO:1902883 1.10% negative regulation of response to oxidative stress
GO:0001501 1.10% skeletal system development
GO:0044706 1.10% multi-multicellular organism process
GO:0006367 1.10% transcription initiation from RNA polymerase II promoter
GO:0043161 1.10% proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0032355 1.10% response to estradiol
GO:0009130 1.10% pyrimidine nucleoside monophosphate biosynthetic process
GO:0008360 1.10% regulation of cell shape
GO:0120161 1.10% regulation of cold-induced thermogenesis
GO:0002009 1.10% morphogenesis of an epithelium
GO:0006073 1.10% cellular glucan metabolic process
GO:0042537 1.10% benzene-containing compound metabolic process
GO:0016114 1.10% terpenoid biosynthetic process
GO:0018205 1.10% peptidyl-lysine modification
GO:0010165 1.10% response to X-ray
GO:2001238 1.10% positive regulation of extrinsic apoptotic signaling pathway
GO:0042753 1.10% positive regulation of circadian rhythm
GO:0034766 1.10% negative regulation of ion transmembrane transport
GO:0050878 1.10% regulation of body fluid levels
GO:0034755 1.09% iron ion transmembrane transport
GO:0016197 1.09% endosomal transport
GO:0006783 1.09% heme biosynthetic process
GO:0045940 1.09% positive regulation of steroid metabolic process
GO:0051091 1.09% positive regulation of DNA-binding transcription factor activity
GO:0051146 1.09% striated muscle cell differentiation
GO:0051169 1.09% nuclear transport
GO:0010498 1.09% proteasomal protein catabolic process
GO:0045039 1.09% protein insertion into mitochondrial inner membrane
GO:0051930 1.09% regulation of sensory perception of pain
GO:0030100 1.09% regulation of endocytosis
GO:0034637 1.09% cellular carbohydrate biosynthetic process
GO:0046834 1.09% lipid phosphorylation
GO:0032970 1.09% regulation of actin filament-based process
GO:0046928 1.09% regulation of neurotransmitter secretion
GO:0002028 1.09% regulation of sodium ion transport
GO:0071071 1.08% regulation of phospholipid biosynthetic process
GO:0055092 1.08% sterol homeostasis
GO:2000300 1.08% regulation of synaptic vesicle exocytosis
GO:0046434 1.08% organophosphate catabolic process
GO:0043903 1.08% regulation of symbiosis, encompassing mutualism through parasitism
GO:1901657 1.08% glycosyl compound metabolic process
GO:1904396 1.08% regulation of neuromuscular junction development
GO:0006560 1.08% proline metabolic process
GO:0043244 1.08% regulation of protein complex disassembly
GO:0009798 1.08% axis specification
GO:0095500 1.08% acetylcholine receptor signaling pathway
GO:0031279 1.08% regulation of cyclase activity
GO:0009310 1.08% amine catabolic process
GO:0032200 1.08% telomere organization
GO:0045321 1.08% leukocyte activation
GO:0009205 1.08% purine ribonucleoside triphosphate metabolic process
GO:0042417 1.08% dopamine metabolic process
GO:0006541 1.07% glutamine metabolic process
GO:0002931 1.07% response to ischemia
GO:0019827 1.07% stem cell population maintenance
GO:0042762 1.07% regulation of sulfur metabolic process
GO:2001023 1.07% regulation of response to drug
GO:1903793 1.07% positive regulation of anion transport
GO:0043410 1.07% positive regulation of MAPK cascade
GO:0050765 1.07% negative regulation of phagocytosis
GO:0071230 1.07% cellular response to amino acid stimulus
GO:0050905 1.07% neuromuscular process
GO:0009612 1.07% response to mechanical stimulus
GO:0007638 1.07% mechanosensory behavior
GO:0098727 1.07% maintenance of cell number
GO:0010226 1.07% response to lithium ion
GO:0030155 1.06% regulation of cell adhesion
GO:0006997 1.06% nucleus organization
GO:0044380 1.06% protein localization to cytoskeleton
GO:0007519 1.06% skeletal muscle tissue development
GO:1901215 1.06% negative regulation of neuron death
GO:0035383 1.06% thioester metabolic process
GO:0045793 1.06% positive regulation of cell size
GO:0000413 1.06% protein peptidyl-prolyl isomerization
GO:0048872 1.06% homeostasis of number of cells
GO:1900120 1.06% regulation of receptor binding
GO:0031623 1.06% receptor internalization
GO:0097485 1.06% neuron projection guidance
GO:0035303 1.06% regulation of dephosphorylation
GO:0006913 1.06% nucleocytoplasmic transport
GO:0043009 1.06% chordate embryonic development
GO:0016072 1.05% rRNA metabolic process
GO:0006450 1.05% regulation of translational fidelity
GO:2001039 1.05% negative regulation of cellular response to drug
GO:0010557 1.05% positive regulation of macromolecule biosynthetic process
GO:0007631 1.05% feeding behavior
GO:0031297 1.05% replication fork processing
GO:0009110 1.05% vitamin biosynthetic process
GO:0051640 1.05% organelle localization
GO:0042538 1.05% hyperosmotic salinity response
GO:0040018 1.05% positive regulation of multicellular organism growth
GO:0060918 1.05% auxin transport
GO:0018208 1.05% peptidyl-proline modification
GO:0031175 1.04% neuron projection development
GO:0030334 1.04% regulation of cell migration
GO:0000959 1.04% mitochondrial RNA metabolic process
GO:0019321 1.04% pentose metabolic process
GO:0050777 1.04% negative regulation of immune response
GO:0035148 1.04% tube formation
GO:0042136 1.04% neurotransmitter biosynthetic process
GO:0010332 1.04% response to gamma radiation
GO:0050806 1.04% positive regulation of synaptic transmission
GO:0006526 1.04% arginine biosynthetic process
GO:0007286 1.04% spermatid development
GO:0003002 1.04% regionalization
GO:0051100 1.04% negative regulation of binding
GO:0006108 1.04% malate metabolic process
GO:0007020 1.04% microtubule nucleation
GO:0007098 1.04% centrosome cycle
GO:0042044 1.04% fluid transport
GO:0010951 1.04% negative regulation of endopeptidase activity
GO:0032990 1.04% cell part morphogenesis
GO:0030324 1.03% lung development
GO:0030433 1.03% ubiquitin-dependent ERAD pathway
GO:0043574 1.03% peroxisomal transport
GO:0009850 1.03% auxin metabolic process
GO:0008286 1.03% insulin receptor signaling pathway
GO:0006521 1.03% regulation of cellular amino acid metabolic process
GO:0098693 1.03% regulation of synaptic vesicle cycle
GO:0006625 1.03% protein targeting to peroxisome
GO:0016036 1.03% cellular response to phosphate starvation
GO:2000008 1.03% regulation of protein localization to cell surface
GO:0032148 1.03% activation of protein kinase B activity
GO:0033692 1.03% cellular polysaccharide biosynthetic process
GO:0044273 1.03% sulfur compound catabolic process
GO:0071542 1.02% dopaminergic neuron differentiation
GO:0006012 1.02% galactose metabolic process
GO:0048771 1.02% tissue remodeling
GO:0010228 1.02% vegetative to reproductive phase transition of meristem
GO:0043954 1.02% cellular component maintenance
GO:0060322 1.02% head development
GO:0043392 1.02% negative regulation of DNA binding
GO:1904950 1.02% negative regulation of establishment of protein localization
GO:0042402 1.02% cellular biogenic amine catabolic process
GO:0006637 1.02% acyl-CoA metabolic process
GO:0021987 1.02% cerebral cortex development
GO:0042447 1.02% hormone catabolic process
GO:0033555 1.01% multicellular organismal response to stress
GO:0032273 1.01% positive regulation of protein polymerization
GO:0051224 1.01% negative regulation of protein transport
GO:0002244 1.01% hematopoietic progenitor cell differentiation
GO:0035335 1.01% peptidyl-tyrosine dephosphorylation
GO:0032069 1.01% regulation of nuclease activity
GO:0070417 1.01% cellular response to cold
GO:0001835 1.01% blastocyst hatching
GO:0030048 1.01% actin filament-based movement
GO:0009635 1.01% response to herbicide
GO:0006364 1.01% rRNA processing
GO:0006855 1.01% drug transmembrane transport
GO:0070507 1.01% regulation of microtubule cytoskeleton organization
GO:0009582 1.01% detection of abiotic stimulus
GO:2000278 1.01% regulation of DNA biosynthetic process
GO:0006282 1.00% regulation of DNA repair
GO:0000105 1.00% histidine biosynthetic process
GO:0036503 1.00% ERAD pathway
GO:0007411 1.00% axon guidance
GO:0043268 1.00% positive regulation of potassium ion transport
GO:0043650 1.00% dicarboxylic acid biosynthetic process
GO:0030010 1.00% establishment of cell polarity
GO:1902884 1.00% positive regulation of response to oxidative stress
GO:0051493 1.00% regulation of cytoskeleton organization
Back
Download
TOP