TOP
UniProt ID:
P81180
Entry Name:
CVN_NOSEL
Sequence:
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
Score (%) 5.67~28.51
GO Terms Score Description
GO:0005575 28.51% cellular_component
GO:0110165 25.77% cellular anatomical entity
GO:0005829 19.33% cytosol
GO:0005737 18.14% cytoplasm
GO:0043227 15.11% membrane-bounded organelle
GO:0043231 15.03% intracellular membrane-bounded organelle
GO:0043226 14.80% organelle
GO:0043229 14.80% intracellular organelle
GO:0005634 13.32% nucleus
GO:0032991 12.76% protein-containing complex
GO:0016020 9.89% membrane
GO:0005886 8.83% plasma membrane
GO:1902494 8.54% catalytic complex
GO:0005739 8.19% mitochondrion
GO:1990234 8.05% transferase complex
GO:0098796 7.70% membrane protein complex
GO:0005576 6.81% extracellular region
GO:0005615 6.46% extracellular space
GO:0009536 6.45% plastid
GO:0005654 6.16% nucleoplasm
GO:1990204 5.98% oxidoreductase complex
GO:0005667 5.86% transcription factor complex
GO:0009507 5.84% chloroplast
GO:0070013 5.69% intracellular organelle lumen
GO:0043228 5.67% non-membrane-bounded organelle
GO:0043233 5.63% organelle lumen
GO:1990904 5.62% ribonucleoprotein complex
GO:0031974 5.57% membrane-enclosed lumen
GO:0043232 5.44% intracellular non-membrane-bounded organelle
GO:0031982 5.30% vesicle
GO:0061695 5.25% transferase complex, transferring phosphorus-containing groups
GO:0017053 5.14% transcriptional repressor complex
GO:0005783 5.00% endoplasmic reticulum
GO:0098798 4.96% mitochondrial protein complex
GO:0031090 4.92% organelle membrane
GO:0016604 4.88% nuclear body
GO:0098797 4.79% plasma membrane protein complex
GO:0031410 4.70% cytoplasmic vesicle
GO:0005773 4.69% vacuole
GO:0097708 4.67% intracellular vesicle
GO:0032153 4.67% cell division site
GO:0032993 4.60% protein-DNA complex
GO:0009570 4.54% chloroplast stroma
GO:0042597 4.53% periplasmic space
GO:0009532 4.52% plastid stroma
GO:0031224 4.52% intrinsic component of membrane
GO:0005759 4.39% mitochondrial matrix
GO:0070993 4.37% translation preinitiation complex
GO:0016282 4.27% eukaryotic 43S preinitiation complex
GO:0009295 4.23% nucleoid
GO:0005815 4.20% microtubule organizing center
GO:0016021 4.18% integral component of membrane
GO:0005758 4.18% mitochondrial intermembrane space
GO:0031967 4.18% organelle envelope
GO:0005938 4.15% cell cortex
GO:0031975 4.14% envelope
GO:0031970 4.13% organelle envelope lumen
GO:0098588 4.09% bounding membrane of organelle
GO:1990351 3.94% transporter complex
GO:0098805 3.88% whole membrane
GO:0042579 3.84% microbody
GO:0098800 3.79% inner mitochondrial membrane protein complex
GO:0051286 3.77% cell tip
GO:0044798 3.76% nuclear transcription factor complex
GO:0101031 3.71% chaperone complex
GO:0005777 3.69% peroxisome
GO:0070062 3.66% extracellular exosome
GO:1903561 3.64% extracellular vesicle
GO:0099080 3.61% supramolecular complex
GO:0043230 3.61% extracellular organelle
GO:0031966 3.59% mitochondrial membrane
GO:0016592 3.57% mediator complex
GO:0031012 3.57% extracellular matrix
GO:0042995 3.51% cell projection
GO:0000785 3.49% chromatin
GO:0090575 3.48% RNA polymerase II transcription factor complex
GO:0000323 3.48% lytic vacuole
GO:0016607 3.47% nuclear speck
GO:0030288 3.46% outer membrane-bounded periplasmic space
GO:0005774 3.44% vacuolar membrane
GO:0000329 3.44% fungal-type vacuole membrane
GO:0048471 3.40% perinuclear region of cytoplasm
GO:0019898 3.39% extrinsic component of membrane
GO:0030880 3.38% RNA polymerase complex
GO:0005794 3.35% Golgi apparatus
GO:0044391 3.35% ribosomal subunit
GO:0033178 3.33% proton-transporting two-sector ATPase complex, catalytic domain
GO:0042651 3.32% thylakoid membrane
GO:0000428 3.31% DNA-directed RNA polymerase complex
GO:0034708 3.30% methyltransferase complex
GO:0098852 3.30% lytic vacuole membrane
GO:0005840 3.25% ribosome
GO:0005730 3.25% nucleolus
GO:0015935 3.24% small ribosomal subunit
GO:0045335 3.23% phagocytic vesicle
GO:0005856 3.22% cytoskeleton
GO:0043332 3.21% mating projection tip
GO:0061645 3.19% endocytic patch
GO:0008023 3.19% transcription elongation factor complex
GO:0030139 3.16% endocytic vesicle
GO:0098803 3.16% respiratory chain complex
GO:0034357 3.15% photosynthetic membrane
GO:0031984 3.13% organelle subcompartment
GO:0030479 3.11% actin cortical patch
GO:0099738 3.08% cell cortex region
GO:0016469 3.08% proton-transporting two-sector ATPase complex
GO:0005764 3.04% lysosome
GO:0030054 3.04% cell junction
GO:0090568 2.99% nuclear transcriptional repressor complex
GO:0009535 2.97% chloroplast thylakoid membrane
GO:0070069 2.95% cytochrome complex
GO:0005813 2.94% centrosome
GO:0005768 2.94% endosome
GO:1904949 2.93% ATPase complex
GO:0005874 2.93% microtubule
GO:0030427 2.91% site of polarized growth
GO:0070603 2.90% SWI/SNF superfamily-type complex
GO:0099512 2.90% supramolecular fiber
GO:0000325 2.89% plant-type vacuole
GO:0099081 2.89% supramolecular polymer
GO:0055035 2.87% plastid thylakoid membrane
GO:0045271 2.86% respiratory chain complex I
GO:0030964 2.82% NADH dehydrogenase complex
GO:0099503 2.82% secretory vesicle
GO:0009941 2.81% chloroplast envelope
GO:0009526 2.81% plastid envelope
GO:0001917 2.78% photoreceptor inner segment
GO:0005635 2.77% nuclear envelope
GO:0048046 2.76% apoplast
GO:0019866 2.76% organelle inner membrane
GO:0000324 2.76% fungal-type vacuole
GO:0099513 2.74% polymeric cytoskeletal fiber
GO:0000322 2.74% storage vacuole
GO:0019897 2.74% extrinsic component of plasma membrane
GO:0055029 2.69% nuclear DNA-directed RNA polymerase complex
GO:0001533 2.68% cornified envelope
GO:0005743 2.65% mitochondrial inner membrane
GO:0009579 2.65% thylakoid
GO:0120025 2.65% plasma membrane bounded cell projection
GO:0033643 2.63% host cell part
GO:0000151 2.62% ubiquitin ligase complex
GO:0019867 2.60% outer membrane
GO:0005681 2.58% spliceosomal complex
GO:0120114 2.58% Sm-like protein family complex
GO:0008180 2.56% COP9 signalosome
GO:0090734 2.55% site of DNA damage
GO:0000781 2.55% chromosome, telomeric region
GO:0005694 2.49% chromosome
GO:0015934 2.46% large ribosomal subunit
GO:0005929 2.46% cilium
GO:0005747 2.46% mitochondrial respiratory chain complex I
GO:0018995 2.46% host cellular component
GO:0005751 2.44% mitochondrial respiratory chain complex IV
GO:0022627 2.42% cytosolic small ribosomal subunit
GO:0000118 2.42% histone deacetylase complex
GO:0031430 2.42% M band
GO:0043190 2.41% ATP-binding cassette (ABC) transporter complex
GO:0099568 2.38% cytoplasmic region
GO:1902493 2.38% acetyltransferase complex
GO:0005819 2.37% spindle
GO:0035770 2.35% ribonucleoprotein granule
GO:0045239 2.34% tricarboxylic acid cycle enzyme complex
GO:0012505 2.34% endomembrane system
GO:0036464 2.33% cytoplasmic ribonucleoprotein granule
GO:0033202 2.33% DNA helicase complex
GO:0098533 2.33% ATPase dependent transmembrane transport complex
GO:0031234 2.32% extrinsic component of cytoplasmic side of plasma membrane
GO:0016459 2.30% myosin complex
GO:0045202 2.30% synapse
GO:0030141 2.29% secretory granule
GO:0045261 2.27% proton-transporting ATP synthase complex, catalytic core F(1)
GO:0045277 2.27% respiratory chain complex IV
GO:0009986 2.25% cell surface
GO:0031977 2.24% thylakoid lumen
GO:0005762 2.24% mitochondrial large ribosomal subunit
GO:0045259 2.24% proton-transporting ATP synthase complex
GO:0070847 2.23% core mediator complex
GO:0098687 2.22% chromosomal region
GO:0005782 2.21% peroxisomal matrix
GO:0000315 2.21% organellar large ribosomal subunit
GO:0000123 2.20% histone acetyltransferase complex
GO:0042575 2.20% DNA polymerase complex
GO:1902495 2.19% transmembrane transporter complex
GO:0031248 2.19% protein acetyltransferase complex
GO:0005816 2.19% spindle pole body
GO:0005643 2.18% nuclear pore
GO:0000139 2.16% Golgi membrane
GO:0035861 2.16% site of double-strand break
GO:0031082 2.15% BLOC complex
GO:0010494 2.14% cytoplasmic stress granule
GO:0031907 2.13% microbody lumen
GO:0005669 2.13% transcription factor TFIID complex
GO:0031461 2.11% cullin-RING ubiquitin ligase complex
GO:0005911 2.09% cell-cell junction
GO:0030428 2.09% cell septum
GO:0070469 2.07% respirasome
GO:0099023 2.06% vesicle tethering complex
GO:0031976 2.06% plastid thylakoid
GO:0042170 2.06% plastid membrane
GO:0033176 2.06% proton-transporting V-type ATPase complex
GO:0030532 2.06% small nuclear ribonucleoprotein complex
GO:0009534 2.06% chloroplast thylakoid
GO:0031968 2.04% organelle outer membrane
GO:0033177 2.04% proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0001669 2.03% acrosomal vesicle
GO:0046930 2.03% pore complex
GO:0009521 2.03% photosystem
GO:0033290 2.02% eukaryotic 48S preinitiation complex
GO:0000276 2.01% mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
GO:0097546 2.00% ciliary base
GO:0005680 1.98% anaphase-promoting complex
GO:0005736 1.98% RNA polymerase I complex
GO:0098590 1.97% plasma membrane region
GO:0031226 1.97% intrinsic component of plasma membrane
GO:0045275 1.96% respiratory chain complex III
GO:0034518 1.95% RNA cap binding complex
GO:1990391 1.94% DNA repair complex
GO:0031969 1.94% chloroplast membrane
GO:0005763 1.94% mitochondrial small ribosomal subunit
GO:0031514 1.94% motile cilium
GO:0035267 1.93% NuA4 histone acetyltransferase complex
GO:0043189 1.92% H4/H2A histone acetyltransferase complex
GO:0005875 1.92% microtubule associated complex
GO:0022625 1.91% cytosolic large ribosomal subunit
GO:0045263 1.91% proton-transporting ATP synthase complex, coupling factor F(o)
GO:0005847 1.91% mRNA cleavage and polyadenylation specificity factor complex
GO:0005732 1.89% small nucleolar ribonucleoprotein complex
GO:0000792 1.88% heterochromatin
GO:0097525 1.88% spliceosomal snRNP complex
GO:0070461 1.86% SAGA-type complex
GO:0005849 1.86% mRNA cleavage factor complex
GO:0071944 1.84% cell periphery
GO:0005765 1.84% lysosomal membrane
GO:0016324 1.84% apical plasma membrane
GO:0000314 1.84% organellar small ribosomal subunit
GO:0098791 1.84% Golgi subcompartment
GO:0005789 1.83% endoplasmic reticulum membrane
GO:0031312 1.83% extrinsic component of organelle membrane
GO:0005753 1.82% mitochondrial proton-transporting ATP synthase complex
GO:0015629 1.82% actin cytoskeleton
GO:0000776 1.79% kinetochore
GO:0031011 1.78% Ino80 complex
GO:0097346 1.78% INO80-type complex
GO:0000152 1.78% nuclear ubiquitin ligase complex
GO:0016514 1.76% SWI/SNF complex
GO:1905360 1.76% GTPase complex
GO:0005666 1.75% RNA polymerase III complex
GO:0030312 1.75% external encapsulating structure
GO:1905368 1.74% peptidase complex
GO:0098793 1.73% presynapse
GO:0000124 1.73% SAGA complex
GO:0022626 1.72% cytosolic ribosome
GO:0033180 1.72% proton-transporting V-type ATPase, V1 domain
GO:0034774 1.71% secretory granule lumen
GO:0043005 1.69% neuron projection
GO:0005618 1.69% cell wall
GO:0031143 1.69% pseudopodium
GO:0031965 1.68% nuclear membrane
GO:0060205 1.68% cytoplasmic vesicle lumen
GO:0005741 1.68% mitochondrial outer membrane
GO:0098636 1.67% protein complex involved in cell adhesion
GO:0005793 1.67% endoplasmic reticulum-Golgi intermediate compartment
GO:0042645 1.67% mitochondrial nucleoid
GO:0034045 1.66% phagophore assembly site membrane
GO:0005665 1.66% RNA polymerase II, core complex
GO:0031983 1.65% vesicle lumen
GO:0005942 1.65% phosphatidylinositol 3-kinase complex
GO:1902562 1.64% H4 histone acetyltransferase complex
GO:0000943 1.64% retrotransposon nucleocapsid
GO:1905348 1.63% endonuclease complex
GO:1902555 1.62% endoribonuclease complex
GO:0072686 1.62% mitotic spindle
GO:0005686 1.61% U2 snRNP
GO:0051285 1.60% cell cortex of cell tip
GO:0009506 1.59% plasmodesma
GO:0042788 1.57% polysomal ribosome
GO:0005769 1.57% early endosome
GO:0043209 1.56% myelin sheath
GO:0005684 1.55% U2-type spliceosomal complex
GO:0062023 1.54% collagen-containing extracellular matrix
GO:0010008 1.54% endosome membrane
GO:0005811 1.53% lipid droplet
GO:0071011 1.52% precatalytic spliceosome
GO:0005852 1.51% eukaryotic translation initiation factor 3 complex
GO:0036452 1.51% ESCRT complex
GO:0000153 1.51% cytoplasmic ubiquitin ligase complex
GO:0031201 1.51% SNARE complex
GO:0000793 1.51% condensed chromosome
GO:0036064 1.49% ciliary basal body
GO:0005801 1.47% cis-Golgi network
GO:0044732 1.47% mitotic spindle pole body
GO:0009528 1.46% plastid inner membrane
GO:0000932 1.45% P-body
GO:0015030 1.44% Cajal body
GO:0031314 1.44% extrinsic component of mitochondrial inner membrane
GO:0009897 1.43% external side of plasma membrane
GO:0030008 1.43% TRAPP complex
GO:0005802 1.43% trans-Golgi network
GO:0005697 1.43% telomerase holoenzyme complex
GO:0009706 1.43% chloroplast inner membrane
GO:0071013 1.43% catalytic step 2 spliceosome
GO:0034399 1.42% nuclear periphery
GO:0005682 1.42% U5 snRNP
GO:0001750 1.42% photoreceptor outer segment
GO:0070938 1.41% contractile ring
GO:0032994 1.41% protein-lipid complex
GO:0098552 1.41% side of membrane
GO:0009279 1.40% cell outer membrane
GO:0000812 1.40% Swr1 complex
GO:0030018 1.40% Z disc
GO:0098978 1.40% glutamatergic synapse
GO:0001650 1.39% fibrillar center
GO:0012506 1.39% vesicle membrane
GO:0005834 1.39% heterotrimeric G-protein complex
GO:0036126 1.37% sperm flagellum
GO:0031301 1.36% integral component of organelle membrane
GO:0070161 1.36% anchoring junction
GO:0035097 1.35% histone methyltransferase complex
GO:0000228 1.34% nuclear chromosome
GO:1904813 1.34% ficolin-1-rich granule lumen
GO:0005912 1.33% adherens junction
GO:0005795 1.32% Golgi stack
GO:0005628 1.32% prospore membrane
GO:0097729 1.31% 9+2 motile cilium
GO:0030659 1.29% cytoplasmic vesicle membrane
GO:1902911 1.29% protein kinase complex
GO:0000786 1.28% nucleosome
GO:0005770 1.28% late endosome
GO:0000502 1.28% proteasome complex
GO:0031300 1.28% intrinsic component of organelle membrane
GO:0019814 1.27% immunoglobulin complex
GO:0009505 1.27% plant-type cell wall
GO:0031462 1.26% Cul2-RING ubiquitin ligase complex
GO:0098802 1.26% plasma membrane signaling receptor complex
GO:0043235 1.26% receptor complex
GO:0005791 1.25% rough endoplasmic reticulum
GO:0097526 1.24% spliceosomal tri-snRNP complex
GO:0016605 1.24% PML body
GO:0044297 1.23% cell body
GO:0005881 1.22% cytoplasmic microtubule
GO:0005887 1.21% integral component of plasma membrane
GO:0009898 1.21% cytoplasmic side of plasma membrane
GO:0000109 1.21% nucleotide-excision repair complex
GO:0005775 1.21% vacuolar lumen
GO:0001891 1.20% phagocytic cup
GO:0098794 1.20% postsynapse
GO:0005640 1.20% nuclear outer membrane
GO:0005685 1.20% U1 snRNP
GO:0030118 1.20% clathrin coat
GO:0009925 1.19% basal plasma membrane
GO:0046540 1.19% U4/U6 x U5 tri-snRNP complex
GO:0005876 1.18% spindle microtubule
GO:0000137 1.18% Golgi cis cisterna
GO:0042641 1.18% actomyosin
GO:0005776 1.17% autophagosome
GO:0005826 1.16% actomyosin contractile ring
GO:1905369 1.16% endopeptidase complex
GO:0044815 1.15% DNA packaging complex
GO:0080008 1.14% Cul4-RING E3 ubiquitin ligase complex
GO:0034451 1.13% centriolar satellite
GO:0031252 1.13% cell leading edge
GO:0034364 1.12% high-density lipoprotein particle
GO:0016363 1.11% nuclear matrix
GO:0044232 1.11% organelle membrane contact site
GO:0072562 1.11% blood microparticle
GO:0005935 1.10% cellular bud neck
GO:0098562 1.10% cytoplasmic side of membrane
GO:0032039 1.09% integrator complex
GO:0000794 1.08% condensed nuclear chromosome
GO:0005700 1.08% polytene chromosome
GO:0030863 1.07% cortical cytoskeleton
GO:0034358 1.07% plasma lipoprotein particle
GO:0043025 1.07% neuronal cell body
GO:0016323 1.07% basolateral plasma membrane
GO:0031253 1.07% cell projection membrane
GO:0045171 1.06% intercellular bridge
GO:0032592 1.06% integral component of mitochondrial membrane
GO:0030496 1.06% midbody
GO:0030424 1.06% axon
GO:0005934 1.05% cellular bud tip
GO:0009524 1.05% phragmoplast
GO:0098573 1.05% intrinsic component of mitochondrial membrane
GO:0031597 1.04% cytosolic proteasome complex
GO:0043596 1.04% nuclear replication fork
GO:1990777 1.03% lipoprotein particle
GO:0030135 1.03% coated vesicle
GO:0070971 1.03% endoplasmic reticulum exit site
GO:0030864 1.03% cortical actin cytoskeleton
GO:0005675 1.01% transcription factor TFIIH holo complex
GO:0031902 1.01% late endosome membrane
GO:0016328 1.00% lateral plasma membrane
TOP