TOP
UniProt ID:
P01034
Entry Name:
CYTC_HUMAN
Sequence:
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Score (%) 23.58~92.07
GO Terms Score Description
GO:0005575 92.07% cellular_component
GO:0110165 90.74% cellular anatomical entity
GO:0005615 63.78% extracellular space
GO:0043226 53.90% organelle
GO:0043227 53.64% membrane-bounded organelle
GO:0031982 49.72% vesicle
GO:0005576 49.32% extracellular region
GO:0043229 43.55% intracellular organelle
GO:0043231 40.28% intracellular membrane-bounded organelle
GO:0005794 33.20% Golgi apparatus
GO:0005783 32.85% endoplasmic reticulum
GO:0097708 32.03% intracellular vesicle
GO:0031410 31.85% cytoplasmic vesicle
GO:0016020 31.29% membrane
GO:0005737 29.83% cytoplasm
GO:0005886 28.57% plasma membrane
GO:0031974 28.20% membrane-enclosed lumen
GO:0070062 27.99% extracellular exosome
GO:0043230 27.88% extracellular organelle
GO:0070013 27.84% intracellular organelle lumen
GO:0043233 27.72% organelle lumen
GO:1903561 27.66% extracellular vesicle
GO:0031012 25.14% extracellular matrix
GO:0062023 24.44% collagen-containing extracellular matrix
GO:0120025 23.58% plasma membrane bounded cell projection
GO:0005773 23.44% vacuole
GO:0042995 23.18% cell projection
GO:0000323 23.01% lytic vacuole
GO:0005764 22.11% lysosome
GO:0048471 22.00% perinuclear region of cytoplasm
GO:0043025 21.26% neuronal cell body
GO:0044297 21.11% cell body
GO:0005788 20.20% endoplasmic reticulum lumen
GO:0043228 20.05% non-membrane-bounded organelle
GO:0043005 20.02% neuron projection
GO:0005768 19.94% endosome
GO:1904813 19.39% ficolin-1-rich granule lumen
GO:0043232 19.24% intracellular non-membrane-bounded organelle
GO:0031090 18.15% organelle membrane
GO:0030424 17.83% axon
GO:0043292 17.55% contractile fiber
GO:0031965 17.02% nuclear membrane
GO:0099080 16.74% supramolecular complex
GO:0099503 16.67% secretory vesicle
GO:0099512 15.91% supramolecular fiber
GO:0005770 15.88% late endosome
GO:0005771 15.82% multivesicular body
GO:0099081 15.74% supramolecular polymer
GO:0005604 15.23% basement membrane
GO:0030141 15.17% secretory granule
GO:0005829 14.80% cytosol
GO:0034774 14.24% secretory granule lumen
GO:0060205 14.13% cytoplasmic vesicle lumen
GO:0031983 13.83% vesicle lumen
GO:0032991 13.24% protein-containing complex
GO:0030133 12.23% transport vesicle
GO:0005796 12.09% Golgi lumen
GO:0005634 12.02% nucleus
GO:0009986 11.96% cell surface
GO:0005775 11.55% vacuolar lumen
GO:0005739 10.54% mitochondrion
GO:0043204 10.49% perikaryon
GO:0035578 10.01% azurophil granule lumen
GO:0005741 9.91% mitochondrial outer membrane
GO:0030426 9.81% growth cone
GO:0098796 9.17% membrane protein complex
GO:0019867 9.12% outer membrane
GO:0045202 8.83% synapse
GO:0031968 8.68% organelle outer membrane
GO:0043235 8.50% receptor complex
GO:0030427 8.38% site of polarized growth
GO:0031967 8.34% organelle envelope
GO:0098562 8.16% cytoplasmic side of membrane
GO:0001669 8.05% acrosomal vesicle
GO:0031975 7.82% envelope
GO:0031966 7.81% mitochondrial membrane
GO:0098552 7.81% side of membrane
GO:0098793 7.64% presynapse
GO:0005929 7.62% cilium
GO:0005902 7.52% microvillus
GO:0031514 7.34% motile cilium
GO:0019898 7.28% extrinsic component of membrane
GO:0030425 7.25% dendrite
GO:0008021 7.20% synaptic vesicle
GO:0005791 7.14% rough endoplasmic reticulum
GO:0005654 7.03% nucleoplasm
GO:0098802 7.01% plasma membrane signaling receptor complex
GO:0044306 6.94% neuron projection terminus
GO:0019866 6.93% organelle inner membrane
GO:0031984 6.93% organelle subcompartment
GO:0043202 6.88% lysosomal lumen
GO:0005759 6.75% mitochondrial matrix
GO:0005795 6.67% Golgi stack
GO:0005635 6.67% nuclear envelope
GO:0070382 6.48% exocytic vesicle
GO:1902494 6.46% catalytic complex
GO:0005743 6.42% mitochondrial inner membrane
GO:0005798 6.34% Golgi-associated vesicle
GO:0098798 6.25% mitochondrial protein complex
GO:0098791 6.24% Golgi subcompartment
GO:0005758 6.22% mitochondrial intermembrane space
GO:0098588 6.09% bounding membrane of organelle
GO:0098797 6.07% plasma membrane protein complex
GO:0031970 6.07% organelle envelope lumen
GO:0009897 6.06% external side of plasma membrane
GO:0045335 5.90% phagocytic vesicle
GO:0016234 5.88% inclusion body
GO:0098978 5.87% glutamatergic synapse
GO:0097729 5.84% 9+2 motile cilium
GO:0043195 5.72% terminal bouton
GO:0098805 5.69% whole membrane
GO:0005840 5.66% ribosome
GO:0005789 5.62% endoplasmic reticulum membrane
GO:0005856 5.57% cytoskeleton
GO:0030139 5.45% endocytic vesicle
GO:0005769 5.45% early endosome
GO:0036126 5.37% sperm flagellum
GO:0030054 5.36% cell junction
GO:0043679 5.16% axon terminus
GO:0030659 5.14% cytoplasmic vesicle membrane
GO:0098685 5.03% Schaffer collateral - CA1 synapse
GO:0031224 5.01% intrinsic component of membrane
GO:0098800 4.99% inner mitochondrial membrane protein complex
GO:0030135 4.91% coated vesicle
GO:0012506 4.86% vesicle membrane
GO:0016021 4.82% integral component of membrane
GO:0042383 4.76% sarcolemma
GO:0031985 4.72% Golgi cisterna
GO:0005730 4.62% nucleolus
GO:0034358 4.58% plasma lipoprotein particle
GO:0098858 4.58% actin-based cell projection
GO:0045277 4.56% respiratory chain complex IV
GO:0031312 4.56% extrinsic component of organelle membrane
GO:0098590 4.54% plasma membrane region
GO:0015630 4.51% microtubule cytoskeleton
GO:0000137 4.50% Golgi cis cisterna
GO:0072562 4.48% blood microparticle
GO:0016363 4.46% nuclear matrix
GO:0022626 4.43% cytosolic ribosome
GO:0031594 4.41% neuromuscular junction
GO:1990777 4.39% lipoprotein particle
GO:0005802 4.36% trans-Golgi network
GO:1990234 4.31% transferase complex
GO:0032994 4.20% protein-lipid complex
GO:0099091 4.20% postsynaptic specialization, intracellular component
GO:0034364 4.09% high-density lipoprotein particle
GO:0005938 4.07% cell cortex
GO:0097060 4.05% synaptic membrane
GO:0012505 3.94% endomembrane system
GO:0031314 3.94% extrinsic component of mitochondrial inner membrane
GO:0005911 3.93% cell-cell junction
GO:1990351 3.91% transporter complex
GO:0016604 3.81% nuclear body
GO:0033116 3.74% endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0000139 3.71% Golgi membrane
GO:0098803 3.69% respiratory chain complex
GO:0030136 3.65% clathrin-coated vesicle
GO:0009898 3.65% cytoplasmic side of plasma membrane
GO:0015629 3.56% actin cytoskeleton
GO:0019897 3.53% extrinsic component of plasma membrane
GO:0030134 3.52% COPII-coated ER to Golgi transport vesicle
GO:0030496 3.52% midbody
GO:0042579 3.48% microbody
GO:0034702 3.46% ion channel complex
GO:0005667 3.44% transcription factor complex
GO:0016324 3.43% apical plasma membrane
GO:0099513 3.42% polymeric cytoskeletal fiber
GO:0070469 3.39% respirasome
GO:0034703 3.38% cation channel complex
GO:0030667 3.38% secretory granule membrane
GO:0070069 3.36% cytochrome complex
GO:0005762 3.34% mitochondrial large ribosomal subunit
GO:0005581 3.32% collagen trimer
GO:0071944 3.32% cell periphery
GO:0016607 3.27% nuclear speck
GO:0030315 3.26% T-tubule
GO:1902495 3.25% transmembrane transporter complex
GO:0031228 3.21% intrinsic component of Golgi membrane
GO:0030658 3.15% transport vesicle membrane
GO:0000315 3.14% organellar large ribosomal subunit
GO:0015934 3.14% large ribosomal subunit
GO:0098878 3.11% neurotransmitter receptor complex
GO:0097225 3.11% sperm midpiece
GO:0048046 3.11% apoplast
GO:0005777 3.09% peroxisome
GO:0046930 3.08% pore complex
GO:0045177 3.07% apical part of cell
GO:0012507 3.03% ER to Golgi transport vesicle membrane
GO:0001533 3.02% cornified envelope
GO:1990904 3.01% ribonucleoprotein complex
GO:0005747 3.01% mitochondrial respiratory chain complex I
GO:0032281 2.98% AMPA glutamate receptor complex
GO:0036464 2.96% cytoplasmic ribonucleoprotein granule
GO:0008328 2.87% ionotropic glutamate receptor complex
GO:0005912 2.82% adherens junction
GO:0044295 2.81% axonal growth cone
GO:0005694 2.78% chromosome
GO:0045211 2.76% postsynaptic membrane
GO:0042611 2.76% MHC protein complex
GO:1905368 2.76% peptidase complex
GO:0044391 2.75% ribosomal subunit
GO:0035770 2.75% ribonucleoprotein granule
GO:0070161 2.75% anchoring junction
GO:0016323 2.74% basolateral plasma membrane
GO:0045121 2.74% membrane raft
GO:0031248 2.74% protein acetyltransferase complex
GO:0098794 2.72% postsynapse
GO:0098857 2.68% membrane microdomain
GO:0043209 2.67% myelin sheath
GO:0030964 2.67% NADH dehydrogenase complex
GO:0031045 2.65% dense core granule
GO:0031226 2.62% intrinsic component of plasma membrane
GO:1902493 2.60% acetyltransferase complex
GO:0030660 2.60% Golgi-associated vesicle membrane
GO:0009507 2.58% chloroplast
GO:0090575 2.58% RNA polymerase II transcription factor complex
GO:0005874 2.57% microtubule
GO:0045271 2.55% respiratory chain complex I
GO:0005763 2.55% mitochondrial small ribosomal subunit
GO:0030173 2.50% integral component of Golgi membrane
GO:0005793 2.48% endoplasmic reticulum-Golgi intermediate compartment
GO:0000314 2.47% organellar small ribosomal subunit
GO:0009536 2.47% plastid
GO:0005782 2.45% peroxisomal matrix
GO:0099023 2.45% vesicle tethering complex
GO:0031907 2.44% microbody lumen
GO:0030120 2.38% vesicle coat
GO:0005819 2.37% spindle
GO:1990204 2.37% oxidoreductase complex
GO:0030312 2.33% external encapsulating structure
GO:0030117 2.32% membrane coat
GO:0044798 2.31% nuclear transcription factor complex
GO:0031225 2.30% anchored component of membrane
GO:0099568 2.29% cytoplasmic region
GO:0005751 2.28% mitochondrial respiratory chain complex IV
GO:0015935 2.28% small ribosomal subunit
GO:0031901 2.27% early endosome membrane
GO:0005925 2.26% focal adhesion
GO:0005875 2.26% microtubule associated complex
GO:0042645 2.25% mitochondrial nucleoid
GO:0061695 2.23% transferase complex, transferring phosphorus-containing groups
GO:0005924 2.23% cell-substrate adherens junction
GO:0098799 2.22% outer mitochondrial membrane protein complex
GO:0005801 2.21% cis-Golgi network
GO:0005887 2.20% integral component of plasma membrane
GO:0000118 2.19% histone deacetylase complex
GO:0005618 2.18% cell wall
GO:0055037 2.18% recycling endosome
GO:0098589 2.17% membrane region
GO:0000785 2.16% chromatin
GO:0030055 2.16% cell-substrate junction
GO:0042101 2.14% T cell receptor complex
GO:0000322 2.14% storage vacuole
GO:0034707 2.12% chloride channel complex
GO:0032580 2.11% Golgi cisterna membrane
GO:0101031 2.11% chaperone complex
GO:0030008 2.09% TRAPP complex
GO:0031301 2.08% integral component of organelle membrane
GO:0000324 2.07% fungal-type vacuole
GO:0005774 2.03% vacuolar membrane
GO:0030666 2.00% endocytic vesicle membrane
GO:0031300 1.99% intrinsic component of organelle membrane
GO:0097228 1.98% sperm principal piece
GO:0014069 1.96% postsynaptic density
GO:0070461 1.95% SAGA-type complex
GO:0099572 1.95% postsynaptic specialization
GO:0030027 1.95% lamellipodium
GO:0000792 1.93% heterochromatin
GO:0030662 1.92% coated vesicle membrane
GO:0001650 1.91% fibrillar center
GO:0017053 1.90% transcriptional repressor complex
GO:0009506 1.90% plasmodesma
GO:0031461 1.90% cullin-RING ubiquitin ligase complex
GO:0072686 1.88% mitotic spindle
GO:0008076 1.88% voltage-gated potassium channel complex
GO:0018995 1.87% host cellular component
GO:0033017 1.87% sarcoplasmic reticulum membrane
GO:0005811 1.87% lipid droplet
GO:0042597 1.87% periplasmic space
GO:0046658 1.87% anchored component of plasma membrane
GO:0005666 1.86% RNA polymerase III complex
GO:0000123 1.86% histone acetyltransferase complex
GO:0031082 1.84% BLOC complex
GO:0030670 1.81% phagocytic vesicle membrane
GO:0034705 1.81% potassium channel complex
GO:1905369 1.81% endopeptidase complex
GO:0098636 1.81% protein complex involved in cell adhesion
GO:0000151 1.78% ubiquitin ligase complex
GO:0000124 1.75% SAGA complex
GO:0030017 1.74% sarcomere
GO:0019005 1.73% SCF ubiquitin ligase complex
GO:0042470 1.72% melanosome
GO:0016235 1.70% aggresome
GO:0000793 1.65% condensed chromosome
GO:0005815 1.64% microtubule organizing center
GO:0098862 1.63% cluster of actin-based cell projections
GO:0010008 1.63% endosome membrane
GO:0031977 1.62% thylakoid lumen
GO:0005765 1.62% lysosomal membrane
GO:0048770 1.61% pigment granule
GO:0016514 1.61% SWI/SNF complex
GO:0009295 1.60% nucleoid
GO:0042651 1.60% thylakoid membrane
GO:0009505 1.58% plant-type cell wall
GO:0000325 1.58% plant-type vacuole
GO:0044291 1.57% cell-cell contact zone
GO:0044853 1.57% plasma membrane raft
GO:0034357 1.56% photosynthetic membrane
GO:0031201 1.56% SNARE complex
GO:0033177 1.56% proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0005901 1.54% caveola
GO:0005930 1.54% axoneme
GO:0010494 1.53% cytoplasmic stress granule
GO:0055035 1.52% plastid thylakoid membrane
GO:0009535 1.52% chloroplast thylakoid membrane
GO:0098852 1.51% lytic vacuole membrane
GO:0014704 1.51% intercalated disc
GO:0000776 1.50% kinetochore
GO:0001772 1.50% immunological synapse
GO:0032809 1.49% neuronal cell body membrane
GO:0031526 1.47% brush border membrane
GO:0005881 1.46% cytoplasmic microtubule
GO:0016459 1.44% myosin complex
GO:0000786 1.44% nucleosome
GO:1990391 1.44% DNA repair complex
GO:0042571 1.43% immunoglobulin complex, circulating
GO:0031253 1.43% cell projection membrane
GO:0005903 1.43% brush border
GO:0005868 1.42% cytoplasmic dynein complex
GO:0005732 1.41% small nucleolar ribonucleoprotein complex
GO:0009534 1.40% chloroplast thylakoid
GO:0031307 1.38% integral component of mitochondrial outer membrane
GO:0001917 1.37% photoreceptor inner segment
GO:0070603 1.36% SWI/SNF superfamily-type complex
GO:0098573 1.35% intrinsic component of mitochondrial membrane
GO:0016469 1.34% proton-transporting two-sector ATPase complex
GO:0000421 1.34% autophagosome membrane
GO:0001891 1.34% phagocytic cup
GO:0031227 1.34% intrinsic component of endoplasmic reticulum membrane
GO:0009570 1.34% chloroplast stroma
GO:0005637 1.33% nuclear inner membrane
GO:0033643 1.31% host cell part
GO:0031941 1.31% filamentous actin
GO:0030286 1.31% dynein complex
GO:0099501 1.30% exocytic vesicle membrane
GO:0005882 1.30% intermediate filament
GO:0030018 1.30% Z disc
GO:0030672 1.29% synaptic vesicle membrane
GO:0009279 1.29% cell outer membrane
GO:0032432 1.29% actin filament bundle
GO:0005744 1.29% TIM23 mitochondrial import inner membrane translocase complex
GO:0031519 1.28% PcG protein complex
GO:0031976 1.27% plastid thylakoid
GO:0019814 1.27% immunoglobulin complex
GO:0005813 1.27% centrosome
GO:0032838 1.26% plasma membrane bounded cell projection cytoplasm
GO:0009579 1.26% thylakoid
GO:0022625 1.26% cytosolic large ribosomal subunit
GO:0005753 1.25% mitochondrial proton-transporting ATP synthase complex
GO:0031143 1.24% pseudopodium
GO:0098984 1.23% neuron to neuron synapse
GO:0009925 1.23% basal plasma membrane
GO:0030669 1.23% clathrin-coated endocytic vesicle membrane
GO:0051286 1.23% cell tip
GO:0005921 1.23% gap junction
GO:0045171 1.22% intercellular bridge
GO:0034045 1.22% phagophore assembly site membrane
GO:0009532 1.21% plastid stroma
GO:0031306 1.21% intrinsic component of mitochondrial outer membrane
GO:0030176 1.21% integral component of endoplasmic reticulum membrane
GO:0044298 1.18% cell body membrane
GO:0044232 1.18% organelle membrane contact site
GO:0070821 1.18% tertiary granule membrane
GO:0005681 1.18% spliceosomal complex
GO:0005778 1.18% peroxisomal membrane
GO:0031463 1.17% Cul3-RING ubiquitin ligase complex
GO:0030288 1.17% outer membrane-bounded periplasmic space
GO:0031234 1.17% extrinsic component of cytoplasmic side of plasma membrane
GO:0001750 1.16% photoreceptor outer segment
GO:0032588 1.16% trans-Golgi network membrane
GO:0005826 1.16% actomyosin contractile ring
GO:0060076 1.15% excitatory synapse
GO:1905348 1.15% endonuclease complex
GO:0031252 1.15% cell leading edge
GO:0035579 1.14% specific granule membrane
GO:1904949 1.14% ATPase complex
GO:0045263 1.14% proton-transporting ATP synthase complex, coupling factor F(o)
GO:0045259 1.14% proton-transporting ATP synthase complex
GO:0031233 1.14% intrinsic component of external side of plasma membrane
GO:0000152 1.13% nuclear ubiquitin ligase complex
GO:0033176 1.13% proton-transporting V-type ATPase complex
GO:0097730 1.12% non-motile cilium
GO:0031903 1.12% microbody membrane
GO:0032592 1.11% integral component of mitochondrial membrane
GO:0000428 1.11% DNA-directed RNA polymerase complex
GO:0032839 1.11% dendrite cytoplasm
GO:0016529 1.10% sarcoplasmic reticulum
GO:0009277 1.09% fungal-type cell wall
GO:0030665 1.08% clathrin-coated vesicle membrane
GO:0000812 1.08% Swr1 complex
GO:0009941 1.07% chloroplast envelope
GO:0042788 1.07% polysomal ribosome
GO:0030126 1.06% COPI vesicle coat
GO:0000138 1.06% Golgi trans cisterna
GO:0009526 1.06% plastid envelope
GO:0002080 1.05% acrosomal membrane
GO:0120111 1.05% neuron projection cytoplasm
GO:0097038 1.03% perinuclear endoplasmic reticulum
GO:0032982 1.03% myosin filament
GO:0005790 1.02% smooth endoplasmic reticulum
GO:0017119 1.02% Golgi transport complex
GO:0098687 1.02% chromosomal region
GO:0022627 1.02% cytosolic small ribosomal subunit
GO:0099738 1.02% cell cortex region
GO:0005876 1.00% spindle microtubule
TOP